KEGG   Drosophila mojavensis: Dmoj_GI24772Help
Entry
Dmoj_GI24772      CDS       T01062                                 

Definition
GI24772 gene product from transcript GI24772-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dmo  Drosophila mojavensis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dmoj_GI24772
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dmoj_GI24772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MLKHKLDRQTKALDLRKTESLPTIDQKFYAFECKLNEELAQLELPKEISCIYNPVEYASD
LHCAYLKKYLNGTKNVVFIGINPGPKGMCQTGIPFGNVGTIRNKMQLSGEVQQPPLLHAK
RPVTGLNYRTEEQSGLRLWNLFEELAGSLDVFFQQCFVHNLCPLAFFDEKGGNVTPDHLK
GEYKTLIRDKCLMTLEKQLELLRPQFVVAIGSWVEIELKKSSSYCKSNATVIRLKHPSMR
VPNNTKWAEEAKAFLEEKDLIKYICNKPQGYRVLSEEMEVHLKV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacacaagctcgataggcaaacgaaggctcttgatctaaggaaaactgaatca
ctgccaacaatcgaccaaaaattttatgcctttgaatgcaagttgaatgaagaactagcg
cagcttgagttaccaaaggagatttcttgtatttacaatcccgtcgagtatgcgtcagac
ttacattgcgcatatttaaaaaagtatttaaatggaaccaaaaatgttgtgtttattggc
ataaatcctgggccaaaggggatgtgccagacaggcatacctttcggcaacgttggcact
atccgtaataagatgcaactttctggtgaagtgcaacagccgcccttgttacatgctaaa
cgacctgttacaggcttaaattacagaactgaggagcagagtggattacgtttgtggaat
ctatttgaggaattggctggtagccttgatgtattctttcaacaatgctttgtgcacaac
ttatgtcctttggcgttttttgatgaaaaaggtgggaatgtaacacctgaccacctgaag
ggcgaatacaagacgttgatacgagacaagtgcttgatgacattagagaagcagctcgaa
ttgttgcggccacagtttgttgtggctattggatcgtgggttgagatagagcttaaaaag
agttcgtcttattgtaaatcaaacgcaacagtgattcgtttgaaacacccaagtatgcgt
gtgcccaacaatacaaagtgggcagaagaggcgaaagcatttctggaggaaaaagatcta
atcaaatacatatgtaataagccacaaggctatagagtgttaagcgaagaaatggaagtt
cacctgaaagtataa

DBGET integrated database retrieval system