KEGG   Deinococcus maricopensis: Deima_0157Help
Entry
Deima_0157        CDS       T01412                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dmr  Deinococcus maricopensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Deima_0157
Enzymes [BR:dmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Deima_0157
Peptidases [BR:dmr01002]
 Cysteine Peptidases
  Family C44
   Deima_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179117..180985
Genome map
AA seq 622 aa AA seqDB search
MCGILGSVSDAPAPLGIMALHHRGPDAQAQTRVGSAQLGHARLSIVDLASGAQPMTDTTG
TVTIVFNGEIYNHLTLRRDLEARGQRFATRSDTEVILGLYLAHGVAGFARLRGMYAFAVH
DARDGSTTVARDPFGIKPLFWTRTPRAVHFASELGALLHEAGVTPTLDLTSVLETLTHRY
AFGTHTLYEGVHRLEPGTALVISAHAEVRHVRFTSLAEEVERHRAPGAPAPTDAEVRARF
TDTVEHHTMADVPLGCFLSGGLDSSVVAQRLARTTSEPIRAYAVGFEGATSEASELPYAR
AVADVIGARLREVQVSAADFADLAPVLSGSLNGPLADPADIAMLKLSLAAGTEVKVVLSG
EGGDEAFAGYPKYAADRYARILGPAMRSLAPRLGRRSRVGIAADALARAQRPDRWLRWFE
NDAAPVALMSTLMRGGAQPERARAWVEDRLRAYPRAWSDLQRMQVLDLESWLPNNLLHRG
DYTTMQASIEQRVPLLDLELTPWAVALPDRVKLSGLRGKMPVRRAFASNLPRQVLTRPKS
GFRLPLAEWLREDPTLRGMVHDHLLAPNAGLRAWLDRATLEGLLSPAALASTGGAKLAWT
ALCLELWLQAAHARAPQAAVPA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcattcttggaagcgtctctgacgcccccgctccgctgggcatcatggccctg
catcaccgcggccccgacgcgcaggcgcagacccgtgtcggcagcgcgcagctcggtcac
gcgcgcctcagcatcgtggacctcgccagcggcgcgcagcccatgacggacacgaccggc
accgtcaccatcgtgttcaacggcgagatctacaaccacctcaccctccgccgcgacctg
gaggcgcgcggtcagcgcttcgccacgcgcagtgacaccgaggtgattctcggcctgtac
ctcgcgcacggcgtagccggcttcgcgcgcctgcgcggcatgtacgccttcgccgtgcac
gacgcccgcgacggcagcaccaccgtcgcccgcgacccgttcggtatcaagccgctgttc
tggacgcgcacgccgcgcgccgtgcatttcgcgtccgagctgggcgcgctgctgcacgag
gcgggcgtcacgcccacgctcgacctcacgtccgtgctggagaccctcacgcaccggtac
gcgttcggaacgcacacgctgtacgagggcgtgcaccgcctggagcccggcacggccctc
gtgatcagcgcgcacgccgaggtccgccatgtccgcttcacgagcctcgcggaagaggtc
gagcggcaccgcgcgcccggcgcgcccgcccctacggacgccgaggtgcgggcgcgcttc
acggacaccgtcgagcaccacaccatggcggacgtgccgctcgggtgcttcctgagcggc
ggcctggattccagcgtcgtcgcgcagcgcctcgcgcgcacgacgagcgaaccgatccgc
gcgtacgctgtcgggttcgagggcgccacgtccgaggcgagcgaactgccgtacgcgcgc
gccgtcgcggacgtgatcggcgcgcgcctgcgcgaggtgcaggtgagcgccgcggacttc
gcggacctcgcgcccgtgctgtccggcagcctgaacggcccgctcgccgacccggccgac
atcgccatgctcaagctgtccctcgcggccggcaccgaggtgaaggtcgtcctgtccggt
gagggcggcgacgaagccttcgccggctacccgaagtacgccgcggaccgctacgcccgc
attctcgggccggccatgcgttcgctcgcgccgcgcctggggcgccgcagccgcgtcggc
atcgccgctgacgcgctcgcgcgggcgcaacgcccagaccgctggctccgctggttcgag
aacgacgccgccccggtcgccctcatgagcactctcatgcgcggcggcgcgcaacccgaa
cgcgcgcgcgcctgggtggaggaccgcctgcgcgcctacccgcgcgcctggagtgacctg
cagcgcatgcaggtcctcgacctcgagtcgtggctgccgaacaacctcctgcaccgcggg
gactacaccaccatgcaggcgtccatcgagcagcgcgtgccgctgctggacctggagctc
acgccgtgggcggtggccctgccggaccgcgtgaaactcagcggcctgcgcggcaagatg
ccggtgcgccgcgcgttcgcgtccaacctgccccgacaggtcctcacgcgcccgaagagc
ggcttccgcctgccgctcgccgagtggctccgcgaggacccgaccttgcgcggcatggtg
cacgatcacctgctcgcaccgaacgccggcctgcgcgcgtggctggaccgcgccaccctg
gagggcctgctcagcccggccgcgctcgccagcaccggcggcgcgaagctcgcgtggacg
gcgctgtgcctcgagttgtggctgcaggccgcgcacgcccgcgcacctcaggcagcggtg
cccgcatga

DBGET integrated database retrieval system