KEGG   Deinococcus maricopensis: Deima_0164Help
Entry
Deima_0164        CDS       T01412                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00521  Streptomycin biosynthesis
dmr00523  Polyketide sugar unit biosynthesis
dmr01130  Biosynthesis of antibiotics
Module
dmr_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Deima_0164
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Deima_0164
Enzymes [BR:dmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Deima_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADV65828
UniProt: E8U3F7
Position
complement(188689..189246)
Genome map
AA seq 185 aa AA seqDB search
MIFTETPLRGAFIIDVDVREDERGGFARTYCGREFAEHGLKVDVAQANLSFNHKAGTLRG
MHFQLPPFAETKLVRCTRGAILDVIVDLRPDSPTYLQHVAVELSAENRRALYVPELFAHG
YQALTDGAEVVYQVGEYYTPGHERGLRHDDPRLGLQWPLPVTVISAKDAAWPLLTDERTT
EGVLA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgatcttcacggaaacgcccctgcgcggcgcgttcatcatcgacgtggacgtccgcgag
gacgaacgcggcgggttcgcgcgcacgtactgcggccgggagttcgcggagcacggcctg
aaggtggacgtcgcgcaggcgaacctcagcttcaaccacaaggccggcacgctgcgcggc
atgcacttccagttgccgccgttcgcggagacgaaactggtgcgctgcacgcgcggcgcg
atcctcgacgtcatcgtggacctccgcccggactcgcccacgtacctgcagcacgtcgcc
gtggaactcagcgccgagaaccgccgcgcgctgtacgtcccggagctgttcgcgcacggg
taccaggcgctcacggacggcgcggaggtcgtgtaccaggtcggggagtactacacgccc
gggcacgagcggggcctgcggcacgacgacccgcgcctcggcctgcagtggccgctgccc
gtcacggtcatttccgcgaaggacgccgcgtggccgctcctgacggatgaacgcaccacc
gagggggtgctcgcgtga

DBGET integrated database retrieval system