KEGG   Deinococcus maricopensis: Deima_0210Help
Entry
Deima_0210        CDS       T01412                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dmr  Deinococcus maricopensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deima_0210
Enzymes [BR:dmr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Deima_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243145..244977
Genome map
AA seq 610 aa AA seqDB search
MSYPFCAIVGQDDLKLALTLLAVTPAIGGVLVQGDKGSAKSTTARALAELLPPTGSGAPA
PFVTLPLGATEDRVIGTLDLEKALRGEKALQSGLIRAAHEGVLYIDEVNLLADHLVDVLL
DVAAMGVNRVEREGLAEEHAAVFALIGTMNPEEGTLRPQFLDRFGLCVDVGAPGEARARA
EIVRRRMRYEADPAGFSAAWADAQAALRAQVRGARARYPEVQVSDALLEAISELCQAYGV
RSLRADLVLHRAARALAALDGRREATLEDVKRVAPLVLTHRKRQHPTSPQGGEPDLEQLM
EQLQPPERAPDDAAGSAPDDEPAEAHPDPGPPEDEPAPAETTFRARPPAASPVIDVRGLP
ATHAGRRGTAEEAARGRTVRTRPSPSPSSLALPATLVSAAGRAALDGQAFQVTRADLHER
VREGRVGSRVLFVVDASGSMGARARMEAVKGAALALLADAYARRDEVGVITFRGIAAEVA
LPFTRDVDVARAALDGLPTGGRTPLAHALTLARDVVRRADADGRVLLVLLTDGRGNVPLP
GGGDAWAQALDAAAQLQGTPALVLDTEAGVVRAGRAAEIAGALGAECLTLEALSAEGLTL
TLRGRTLTRA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgagctacccgttttgcgccatcgtcgggcaggacgacctgaagctggccctgacgctg
ctcgccgtcacgcccgccatcgggggcgtgctggtgcagggcgacaagggcagcgcgaaa
agcaccacggcgcgcgcccttgcggagctgctgcccccaaccgggagtggcgcgcccgcg
cccttcgtgaccctgccgctcggcgcgaccgaggaccgcgtgatcggcacgctcgacctc
gagaaggccctgcggggcgagaaggcgctgcagagcggcctgattcgcgcggcgcacgag
ggcgtgctgtacatcgacgaggtgaacctcctcgccgatcacctcgtggacgtgctgctg
gacgtggccgcgatgggcgtgaaccgcgtggagcgcgagggcctcgcggaggagcacgcg
gcggtgttcgcgctgatcggcaccatgaaccccgaggagggcaccctccgcccacagttc
ctggaccggttcgggttgtgcgtggacgtgggcgcgccgggcgaggcgcgcgcgcgggcg
gagatcgtgcggcgccgcatgcggtacgaagcggacccggcgggtttcagtgccgcgtgg
gcggacgcgcaggcggcgctgcgcgcgcaggtgcggggtgcgcgcgcgcggtacccggag
gtgcaggtgtcggacgcgctgctggaggccatcagtgagctgtgccaggcgtacggcgtg
cgcagcctgcgcgcggacctcgtgctgcaccgcgcggcccgcgcgctcgcggcccttgac
ggccgccgcgaggcgacactggaggacgtgaagcgcgttgcgccgctcgtcctgacgcac
cgcaagcgccagcatccgacgtccccgcaggggggtgagccggacctggagcagctgatg
gagcagctgcaaccgccggagcgcgcccccgacgacgcggcggggtcagcgcccgacgac
gaaccggcggaggcgcacccggacccgggccctccggaggacgaaccggcgcccgccgag
acgaccttccgggcgcggccgcccgccgcgtcgccggtgattgacgtgcgggggctgccg
gccacgcacgccgggcggcgcggcaccgcagaggaggctgcgcggggccgcacggtgcgc
acgcgaccgtccccgtccccatcgagcctcgcgttgccggcgacgctcgtgagcgccgcg
ggacgcgccgcgctggacggccaggcgttccaggtgacgcgcgcggacctgcacgagcgc
gttcgggagggccgcgtggggtcgcgcgtgctgttcgtggtggacgcgagcggcagcatg
ggcgcgcgcgcgcgcatggaggccgtgaagggcgcggcgctggcgttgctcgcggacgcg
tacgcgcgccgcgacgaggtgggcgtcatcacgttccgggggattgccgcagaggtcgcg
ttgccgttcacgcgggacgtggacgtcgcgcgcgccgcgctggacggcctgccgaccggg
ggtcgcacgccgctcgcgcacgcgctcacgctcgcgcgggacgtggtgcggcgcgcggac
gcggacgggcgcgtcctgctggtgctgctcacggacgggcgcgggaacgtgccgctgccc
ggcggtggagacgcgtgggcgcaggcgttggacgccgccgcgcagttgcaggggacgccc
gcgctggtgctggacaccgaggcgggcgtggtgcgcgcgggccgcgccgcggagatcgcg
ggggcgctcggcgcggagtgcctgacgctggaagccctgagcgcggagggcctgacgctc
accctgcggggccggacgctcacgcgcgcctga

DBGET integrated database retrieval system