KEGG   Deinococcus maricopensis: Deima_0241Help
Entry
Deima_0241        CDS       T01412                                 

Definition
(RefSeq) glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dmr  Deinococcus maricopensis
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Deima_0241
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Deima_0241
Enzymes [BR:dmr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Deima_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
280730..282094
Genome map
AA seq 454 aa AA seqDB search
MLQALKLSLLSALLLAACTQSPAPTTADAPRVHPGMGLRAASVDRSRLISWDGARTFDFN
GAVDASTITVNENEVLQEIDGFGAALTDSSAWLIQNKLSAAQRNAVMQALFGFNDGNASI
SYLRLPLGGPDFALSHYTFDDSCCDLNGFSIDHDRAYIIPLARQAKSIDGSLNFMATPWS
APAWMKTSGQLGTGKLNPASYPAYATYLRRAYDDYRAAGVTFDAMTIQNEPQFEPGSYPG
MKYEWYDELNFVRDHLAPRMSGTGVKLLTFDHNWGMAWYPRAVLNEGGALYAGSAWHCYG
GNVSAMTDVHNAYPNEGIYLTECSGTHGNGTFAGNLTWNMQHLFIGGVRNWAKTVLLWNL
ALDPSGNPHTGGCSTCRGVITINPSSGQVTYNEAFYAIARFVWPGARRIGSSNSRDGRFI
SAAFRNTNGRKAVVVLNQSAGTGTFRVVAGGPWR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggcactcaagctctcgctgctttccgccctgctgctcgccgcgtgcacgcag
agccccgcgcccaccaccgccgacgcgccgcgcgtccacccgggcatggggctgcgcgcc
gcgtccgtggaccgcagccgcctgatcagctgggacggcgcccgcaccttcgacttcaac
ggcgccgtcgacgcgagcaccatcaccgtcaacgagaacgaggtgctgcaggaaatcgac
gggttcggcgcggcgctcacggacagcagcgcttggctgattcagaacaaactcagcgcc
gcgcaacgcaacgccgttatgcaggcgctgtttggcttcaacgacgggaacgccagcatc
agctacctgcggctcccgctgggcgggccggacttcgcgctcagccactacaccttcgac
gactcctgctgcgacctgaacggcttcagcatcgaccacgaccgcgcgtacatcatcccg
ctcgcgcggcaggcgaaaagcatcgacggcagcctgaacttcatggcgacgccgtggagc
gcacccgcctggatgaagacgagcgggcagctggggaccgggaagctgaacccggcttct
tatccggcctacgcgacctacctgcgccgcgcgtacgacgactaccgcgccgccggcgtg
acgttcgacgccatgaccatccagaacgaaccgcagttcgagccgggcagctaccccggc
atgaagtacgagtggtacgacgagctgaacttcgttcgggatcacctcgcgccgcgcatg
agcggcaccggcgtgaagctgctgacgttcgaccacaactggggcatggcctggtacccg
cgcgccgtcctgaacgagggaggcgcgctgtacgcggggtccgcgtggcactgctatggc
gggaacgtgagcgccatgacggacgtgcacaacgcgtacccgaacgagggcatctacctg
acggagtgctccggcacgcacgggaacggcacgttcgccggcaacctcacgtggaacatg
cagcacctgttcatcggcggcgtgcgcaactgggcgaagacggtgctgctgtggaacctc
gcgctcgacccgagcgggaacccgcacaccggcgggtgcagcacctgccggggcgtcatc
accatcaacccgtcgagtgggcaggtgacgtacaacgaggcgttctacgcgatcgcgcgg
ttcgtatggccgggcgcgcgccgcatcggcagcagcaacagccgcgacgggcgcttcatc
agcgcggcgttccgcaacacgaacggccgcaaggccgtcgtcgtgctgaaccagagtgcg
ggcaccggcaccttccgcgtggtggcgggcggtccgtggcggtga

DBGET integrated database retrieval system