KEGG   Deinococcus maricopensis: Deima_0297Help
Entry
Deima_0297        CDS       T01412                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dmr  Deinococcus maricopensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dmr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dmr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dmr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dmr00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:dmr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
346162..348072
Genome map
AA seq 636 aa AA seqDB search
MEKPLLEHPLVHPPAPLSAAAPVTPDEAARLLALDPPAYWLDIARELTWTTPPDTALDGT
LGDFRYYPGATGNVSVNCLDRHPSERTALLYEREDGHRETWTYGALTDATARFAAALQDL
GVTKGDRVAIYLGNVPEAFIAIHACYRIGAIYSVIFAGFSASAVRDRLVDAQPKVVVCTD
ATLRRGKAVPLKATLDEALRGLHVPHVIVARRVDPAASLREGEHDFHALLQATTRRADPV
PMEANEPGFIIYTSGTTSKPKGLVHAGLGFLAGAYANVKWALNLQPSDVYWCTADVGWLT
FPIFALVGGLAHGATHVIYEGGIDTPTPARPYALIERYGVNKVFTAPTALRMLRRAGDAA
LAPHDLSRLDLISLVGEPLDPETWHWTQGTLGAGRVFVNNTYGQTETGTAWASSMVGLTP
TRPGSCGHPLPGYRARIVRDDGQEAAPGELGALTLTEPFPCLARTVWGDHDRYVQTYLTD
HPGAYAASDAALIDADGQLWVTGRLDDVMNVAGHRIGTMEMEAALITHPAVSEAAVVAQP
DDLKGAVPVAFVVLRGDAATHDGFAGELAEAIVQGVGPIARPARVIVTPTVPRTRSGKIM
RRLLRDLLVTGDVSGDLTSLDNPDAIEVVKGRIAQA
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaaccgttgctggagcaccccctcgtccatccgcccgcaccgctgagcgccgcc
gcgcccgtcacgcccgacgaggccgcgcgcctgctcgccctcgacccgcccgcgtactgg
ctggacatcgcgcgggaactcacgtggaccacgccgccggacaccgccctggacggcacc
ctcggcgacttccgctactacccgggcgccaccgggaacgtcagcgtcaactgcctcgac
cgccacccgtccgaacgcaccgcgctgctctacgaacgcgaggacggccaccgcgaaaca
tggacgtacggcgccctcaccgacgccaccgcgcgcttcgccgcggccctgcaggacctc
ggcgtcacgaaaggcgaccgggtcgccatctacctcgggaacgtccccgaggcgttcatc
gccattcacgcctgctaccgcatcggcgcgatctactccgtcatcttcgcgggcttcagc
gcctccgccgtccgcgaccgcctcgtcgacgcccagccgaaggtcgtcgtctgcaccgac
gcgaccctgcgccgtggcaaggccgtgcccctcaaagccacgctcgacgaggccctccgc
ggtctccacgtaccgcacgtgatcgtcgcgcgccgcgtggaccccgccgcgtccctgcgt
gagggcgagcacgacttccacgcgctcctgcaggccaccacgcgccgcgccgaccccgtc
cccatggaggcgaacgagccgggcttcatcatctatacgtccggcacgacctccaaaccc
aaaggcctcgtgcacgccggcctcgggttcctcgccggcgcgtacgcgaacgtgaaatgg
gccctgaacctccagccgagcgacgtgtactggtgcaccgccgacgtcggctggctgacc
ttcccgatcttcgcgctcgtcggcgggctcgcgcacggcgcgacgcacgtcatctacgag
ggcggcatcgacacgcccacccccgcccggccgtacgccctgatcgagcggtacggcgtg
aacaaggtcttcaccgcccccaccgccctgcggatgctgcgccgcgccggcgacgccgcc
ctcgccccccacgacctcagccgcctcgacctgatcagcctcgtcggcgaaccgctcgac
ccggaaacgtggcactggacgcaaggcacgctcggcgccgggcgcgtgttcgtgaacaac
acgtatggccagacggaaaccggcacggcgtgggcgagcagcatggtgggcctcaccccc
acccggcccggcagttgcggccaccccctgcccggctaccgcgcccgcatcgtccgcgac
gacggtcaggaagccgcgcccggcgaactgggcgcgctcacgctcaccgaaccgttccca
tgcctcgcccgcaccgtctggggcgaccacgaccggtacgtgcagacgtacctcacggac
cacccgggcgcgtacgccgcgtcggacgccgcgctcatcgacgcggacgggcaactgtgg
gtcaccggccgcctcgacgacgtcatgaacgtcgccgggcaccgcatcggcaccatggag
atggaagccgcgctgatcacccacccggccgtcagcgaagcggccgtcgtcgcgcaacct
gacgacctcaagggcgccgtgccggtggcgttcgtggtgcttcgcggcgacgccgccacg
cacgacggcttcgccggggaactcgcggaagccatcgtgcagggtgtcggccccatcgcg
cgcccggcgcgcgtcatcgtcacgccgaccgtgccgcgcacccgcagcggcaagatcatg
cgccgcctcctgcgcgatctgctcgtgaccggcgacgtcagcggcgacctcaccagcctc
gacaaccccgacgccatcgaggtcgtgaaaggccgcatcgcccaggcctga

DBGET integrated database retrieval system