KEGG   Deinococcus maricopensis: Deima_0374Help
Entry
Deima_0374        CDS       T01412                                 

Definition
(RefSeq) D-cysteine desulfhydrase (EC:3.5.99.7 4.4.1.15)
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
dmr  Deinococcus maricopensis
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Deima_0374
Enzymes [BR:dmr01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Deima_0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(437896..438891)
Genome map
AA seq 331 aa AA seqDB search
MHLARFPRRVYTPHATPIEKLTHLSAHLGGPDLYIKRDDLTGLTGGGNKTRKLEFLVADA
LAQGADTLITVGAVQSNHCRLTLAAAVKEGLKCRLVLEQRVPGSYREDASGNNFLFQLLG
VESVTVVDGGSDLNAAMQAIQDDLAREGRKGYIIPGGGSNALGALGYVACAEELLAQTYA
QGLPLDHIVCASGSAGTHAGLLVGLHGNNAQIPLTGINVRRVRDVQEGNVHALAQQTADL
LGLGAVPRGAVTALDEWVGEGYSIPTPGMVEAVQLLARLDGILLDPVYTGKAMAGLIDLV
RRGHFGRGQKVLFVHTGGAPALYAYEDVLRA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcgcccgcttcccacggcgcgtctacaccccccacgccacccccatcgagaaa
ctcacgcacctcagcgcccatctcggcggccctgacctttacatcaaacgcgacgacctc
accggcctcaccggcggcggcaacaaaacccgcaaactcgaattcctcgtagccgacgct
ctcgcgcagggcgccgacacgctcatcaccgtcggcgccgttcagagcaaccactgccgc
ctcaccctcgccgccgccgtcaaggaaggcctcaagtgccgtctggtgctggagcagcgc
gtgcccggcagctaccgcgaggacgccagcggcaacaacttcctgtttcagctgctcggc
gtggaaagcgtcaccgtcgtcgacggcggcagcgacctgaacgccgccatgcaggccatc
caggacgacctcgcccgcgagggccgcaagggctacatcatcccgggcggcggcagcaac
gccctcggcgcgctcgggtacgtcgcctgcgccgaggaactcctcgcgcagacgtacgcg
cagggcctcccgctcgaccacatcgtgtgcgcgagcggcagcgccggcacgcacgccggg
ctgctcgtcggcctgcacggcaacaacgcccagattcccctcaccggcatcaacgtccgc
cgcgtccgtgacgtgcaggaaggcaacgtgcacgcgctcgcgcagcagaccgccgacctg
ctcggcctcggcgctgttccccgcggcgccgtcaccgccctcgacgagtgggtgggggag
gggtactccatccccacgcccggcatggtcgaggccgtgcagctgctcgcacgactcgac
ggcatcctccttgacccggtgtacaccggcaaggccatggctggcctgatcgacctcgtg
cgccgcgggcacttcgggcgtgggcagaaggtgctgttcgtccacaccggcggcgcgccc
gcgctgtacgcgtacgaggacgtgctgcgcgcatga

DBGET integrated database retrieval system