KEGG   Deinococcus maricopensis: Deima_0485Help
Entry
Deima_0485        CDS       T01412                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dmr  Deinococcus maricopensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deima_0485
   01230 Biosynthesis of amino acids
    Deima_0485
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deima_0485
   00030 Pentose phosphate pathway
    Deima_0485
   00051 Fructose and mannose metabolism
    Deima_0485
   00052 Galactose metabolism
    Deima_0485
  Energy metabolism
   00680 Methane metabolism
    Deima_0485
Enzymes [BR:dmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Deima_0485
Protein phosphatases and associated proteins [BR:dmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Deima_0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(574111..575082)
Genome map
AA seq 323 aa AA seqDB search
MTIKRIAVLTSGGDAPGMNAAIRAVVRSATSNGIEVVGVRRGFQGLHEGDMSLLGPRDVA
NTIQRGGTILLTARSRTWRSPEGRALGAEHLRKWHVDGLVVIGGDGSFHGAHYLMEEHGI
PVIGLPGTIDNDLYGTDHTIGYFTAVETALDAVDKLRDTGASHERIFVIEVMGRHAGHIA
LDVAIAGGAEEVFIPEDEKPVADIVHVIQESLRKGKASSIVIVAEGYPGGAMGVAKAIED
GTGLETRVSILGHIQRGGTPVSSDRILASRLGEAAVQAFMDGISGVMVGRTNGEISYTPL
QDTWEKRKDVNRDLYRCAKLLSV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaaacgcatcgccgtgctcaccagcggaggggacgcccccggcatgaacgcc
gcgatccgcgccgtcgtccgctccgccacctcaaacggcatcgaagtcgtcggcgtccgc
cgcggcttccagggcctgcacgaaggcgacatgagcctgctcggcccgcgcgacgtcgcc
aacaccattcagcgcggcggtaccatcctgctcaccgcccgcagccgcacgtggcgcagc
cccgaaggccgcgcactcggcgccgaacacctccgcaagtggcacgtggacggcctcgtc
gtcatcggcggcgacggctccttccacggcgcgcactacctcatggaagaacacggcatc
cccgtgatcggcctgcccggcaccatcgacaacgacctgtacggcaccgaccacaccatc
gggtacttcacggccgtcgaaaccgccctggacgccgtcgacaagctccgcgacaccggc
gccagccacgaacgcatctttgtcatcgaggtcatgggccgccacgccggccacattgcc
ctggacgtcgccatcgccggcggcgccgaggaagtcttcattcccgaggacgagaagccg
gtggcggacatcgtgcacgttattcaggagagcctgcgcaagggcaaggcgagcagcatc
gtgatcgtcgccgaggggtacccgggcggcgcgatgggcgtcgcgaaagccatcgaggac
ggcacgggcctggaaacgcgcgtcagcatcctcgggcacatccagcgtggcggcacgccg
gtcagcagtgaccgcatcctcgcgtcgcgcctcggggaggccgccgtgcaggccttcatg
gacggcatttccggcgtgatggtgggccgcacgaacggcgagatcagctacacgccgctg
caggacacctgggagaaacgcaaggacgtgaaccgcgacctgtaccgctgcgcgaaactg
ctcagcgtctga

DBGET integrated database retrieval system