KEGG   Deinococcus maricopensis: Deima_0485Help
Entry
Deima_0485        CDS       T01412                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00010  Glycolysis / Gluconeogenesis
dmr00030  Pentose phosphate pathway
dmr00051  Fructose and mannose metabolism
dmr00052  Galactose metabolism
dmr00680  Methane metabolism
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01130  Biosynthesis of antibiotics
dmr01200  Carbon metabolism
dmr01230  Biosynthesis of amino acids
dmr03018  RNA degradation
Module
dmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deima_0485
   00030 Pentose phosphate pathway
    Deima_0485
   00051 Fructose and mannose metabolism
    Deima_0485
   00052 Galactose metabolism
    Deima_0485
  Energy metabolism
   00680 Methane metabolism
    Deima_0485
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Deima_0485
Enzymes [BR:dmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Deima_0485
Protein phosphatases and associated proteins [BR:dmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Deima_0485
Messenger RNA biogenesis [BR:dmr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Deima_0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADV66145
UniProt: E8U506
Position
complement(574111..575082)
Genome map
AA seq 323 aa AA seqDB search
MTIKRIAVLTSGGDAPGMNAAIRAVVRSATSNGIEVVGVRRGFQGLHEGDMSLLGPRDVA
NTIQRGGTILLTARSRTWRSPEGRALGAEHLRKWHVDGLVVIGGDGSFHGAHYLMEEHGI
PVIGLPGTIDNDLYGTDHTIGYFTAVETALDAVDKLRDTGASHERIFVIEVMGRHAGHIA
LDVAIAGGAEEVFIPEDEKPVADIVHVIQESLRKGKASSIVIVAEGYPGGAMGVAKAIED
GTGLETRVSILGHIQRGGTPVSSDRILASRLGEAAVQAFMDGISGVMVGRTNGEISYTPL
QDTWEKRKDVNRDLYRCAKLLSV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaaacgcatcgccgtgctcaccagcggaggggacgcccccggcatgaacgcc
gcgatccgcgccgtcgtccgctccgccacctcaaacggcatcgaagtcgtcggcgtccgc
cgcggcttccagggcctgcacgaaggcgacatgagcctgctcggcccgcgcgacgtcgcc
aacaccattcagcgcggcggtaccatcctgctcaccgcccgcagccgcacgtggcgcagc
cccgaaggccgcgcactcggcgccgaacacctccgcaagtggcacgtggacggcctcgtc
gtcatcggcggcgacggctccttccacggcgcgcactacctcatggaagaacacggcatc
cccgtgatcggcctgcccggcaccatcgacaacgacctgtacggcaccgaccacaccatc
gggtacttcacggccgtcgaaaccgccctggacgccgtcgacaagctccgcgacaccggc
gccagccacgaacgcatctttgtcatcgaggtcatgggccgccacgccggccacattgcc
ctggacgtcgccatcgccggcggcgccgaggaagtcttcattcccgaggacgagaagccg
gtggcggacatcgtgcacgttattcaggagagcctgcgcaagggcaaggcgagcagcatc
gtgatcgtcgccgaggggtacccgggcggcgcgatgggcgtcgcgaaagccatcgaggac
ggcacgggcctggaaacgcgcgtcagcatcctcgggcacatccagcgtggcggcacgccg
gtcagcagtgaccgcatcctcgcgtcgcgcctcggggaggccgccgtgcaggccttcatg
gacggcatttccggcgtgatggtgggccgcacgaacggcgagatcagctacacgccgctg
caggacacctgggagaaacgcaaggacgtgaaccgcgacctgtaccgctgcgcgaaactg
ctcagcgtctga

DBGET integrated database retrieval system