KEGG   Deinococcus maricopensis: Deima_0514Help
Entry
Deima_0514        CDS       T01412                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dmr  Deinococcus maricopensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Deima_0514
Enzymes [BR:dmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Deima_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(601226..602137)
Genome map
AA seq 303 aa AA seqDB search
MTHLPYGGIATFARARVAEPGGEWRADVGVLGVPFDIALGFRPGARFAPRALREASLRYA
LPPEGFYDLTRDAYRLAGVTLVDAGDVVLPSLEPELMRERTTVAARQVRARCRVPVFLGG
DHSVTYPLLRAFDDVPDLHVVQLDAHLDFTDERNGTRYSNSSPFRRAAEDLPNLTHITTV
GLRGLRFDAEAVSAARQRGHTLIPMHAVFADLDAVLAQLPTGQNVYISVDVDGFDPAVLP
GTSSPEPDGFTYAQAMRVLAEVARRNTVVGLDVVELAPNLDPTGRSDLLCARLIMETLAE
VFA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacctcccgtacggcggcatcgccaccttcgcgcgcgcgcgggtggcggagcct
ggcggtgagtggcgcgcggatgtcggcgtgctcggcgtgccttttgatatcgccctcggc
ttccggccgggcgcgcgcttcgcgccccgcgcgctgcgcgaggcgagcctgcgctacgcc
ctcccgcccgaggggttctacgacctcacccgcgacgcgtaccgcctcgcgggcgtgacc
ctcgtggacgccggggacgtggtgctgccgtcgcttgaaccggaactgatgcgcgagcgc
accacggtggccgcgcggcaggtgcgcgcgcgctgccgcgtgccggtgttcctcggcggg
gaccacagcgtgacctacccgttgctgcgcgccttcgacgacgtgccggacctgcacgtc
gtgcagcttgacgcgcacctcgacttcacggacgaacgcaacggcacgcgctacagcaac
agcagtcccttccgccgcgcggccgaggacctgccgaacctgacgcacatcacgacggtg
ggcctgcgcggcctgcgcttcgacgcggaagcagtgagcgcggccaggcaacgcggccac
accctgattcccatgcacgccgtgttcgccgacctggacgcggtgctcgcgcagctcccc
accggccagaacgtctacatcagcgtggacgtggacggcttcgacccggccgtgctgccc
ggcacgagcagccccgaaccggacggcttcacgtacgcgcaggccatgcgcgtgctcgcg
gaggtcgcgcggcgcaacaccgtcgtgggcctcgacgtggtggaactcgcgccgaacctc
gacccgaccggccgcagcgacctgctgtgcgcgcgcctcatcatggaaacgctcgcggag
gtgttcgcgtga

DBGET integrated database retrieval system