KEGG   Deinococcus maricopensis: Deima_0548Help
Entry
Deima_0548        CDS       T01412                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00260  Glycine, serine and threonine metabolism
dmr00750  Vitamin B6 metabolism
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01230  Biosynthesis of amino acids
Module
dmr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deima_0548
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Deima_0548
Enzymes [BR:dmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Deima_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF5133
Motif
Other DBs
NCBI-ProteinID: ADV66207
UniProt: E8U568
Position
complement(635275..636312)
Genome map
AA seq 345 aa AA seqDB search
MPGIIDAYRPYLPVTERTPALTLHEGGTPLIHAPRLSAHLGVELYLKYEGLNPTGSFKDR
GMVMAVAKALEDGADTIICASTGNTSAAAAAYAARAGLRCVVLIPDGNIALGKLAQAIAY
GAHVVAINGNFDAALNLVRDISAQHPIALVNSVNPHRLQGQKTAAFEIVDELGGAPDILA
IPVGNAGNISAYWMGFQEYAAAGRSSTTPKMWGFQAEGAAPFIRGAIVDEPETIATAIRI
GNPASAHLARAAVQESAGRFDMASDDEIMHAYNLIAREGVFCEPASATPVAGLLKLHAQG
ELPPGQTVVAVLTGNGLKDPNAALRSVEAPKGVEANMDRVLEAIL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcatcatcgacgcgtaccgcccctacctgcccgttaccgagcgcactcccgcg
ctcaccctgcacgagggcggcaccccgctgattcacgcgccccgactgagcgcgcacctc
ggcgttgagctgtacctgaaatacgaaggcctcaaccccaccggcagcttcaaggaccgc
ggcatggtcatggccgtcgccaaagccctcgaagacggcgcggacaccatcatctgcgcc
agcaccggcaacaccagcgccgccgccgccgcgtacgccgcccgcgccggtctccgctgc
gtcgtgctgatcccggacggcaacatcgccctcgggaagctcgcgcaggccatcgcgtac
ggcgcgcacgtcgtcgccatcaacggcaacttcgacgccgccctgaacctcgtgcgtgac
atcagcgcgcagcaccccattgccctcgtgaacagcgtcaacccgcaccgcctgcagggc
cagaagaccgccgcgttcgaaattgtcgacgaactcgggggcgcgccggacatcctcgcc
atccctgtcgggaacgccgggaacatcagcgcctactggatgggtttccaggaatacgcg
gccgcaggtcggagcagcaccacgccgaaaatgtggggcttccaggcggaaggcgccgcg
ccgttcattcgcggcgccatcgtggacgaaccggaaaccatcgccacggccatccgcatc
ggcaaccccgccagcgcgcacctcgcccgcgccgccgtgcaagaaagcgccgggcgcttc
gacatggcgagcgacgacgagatcatgcacgcctacaacctaattgcgcgcgagggcgtg
ttctgcgaaccggccagcgcgacgcccgtcgcgggcctcctgaagctccacgcgcagggc
gagctgccccccgggcagacggtcgtggccgtgctcaccgggaacggcctgaaagacccg
aacgccgcgctgcgctccgtggaagcgcccaaaggcgtcgaagcgaacatggaccgcgtg
ctggaagccatcctgtga

DBGET integrated database retrieval system