KEGG   Deinococcus maricopensis: Deima_0548Help
Entry
Deima_0548        CDS       T01412                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dmr  Deinococcus maricopensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deima_0548
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deima_0548
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Deima_0548
Enzymes [BR:dmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Deima_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(635275..636312)
Genome map
AA seq 345 aa AA seqDB search
MPGIIDAYRPYLPVTERTPALTLHEGGTPLIHAPRLSAHLGVELYLKYEGLNPTGSFKDR
GMVMAVAKALEDGADTIICASTGNTSAAAAAYAARAGLRCVVLIPDGNIALGKLAQAIAY
GAHVVAINGNFDAALNLVRDISAQHPIALVNSVNPHRLQGQKTAAFEIVDELGGAPDILA
IPVGNAGNISAYWMGFQEYAAAGRSSTTPKMWGFQAEGAAPFIRGAIVDEPETIATAIRI
GNPASAHLARAAVQESAGRFDMASDDEIMHAYNLIAREGVFCEPASATPVAGLLKLHAQG
ELPPGQTVVAVLTGNGLKDPNAALRSVEAPKGVEANMDRVLEAIL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcatcatcgacgcgtaccgcccctacctgcccgttaccgagcgcactcccgcg
ctcaccctgcacgagggcggcaccccgctgattcacgcgccccgactgagcgcgcacctc
ggcgttgagctgtacctgaaatacgaaggcctcaaccccaccggcagcttcaaggaccgc
ggcatggtcatggccgtcgccaaagccctcgaagacggcgcggacaccatcatctgcgcc
agcaccggcaacaccagcgccgccgccgccgcgtacgccgcccgcgccggtctccgctgc
gtcgtgctgatcccggacggcaacatcgccctcgggaagctcgcgcaggccatcgcgtac
ggcgcgcacgtcgtcgccatcaacggcaacttcgacgccgccctgaacctcgtgcgtgac
atcagcgcgcagcaccccattgccctcgtgaacagcgtcaacccgcaccgcctgcagggc
cagaagaccgccgcgttcgaaattgtcgacgaactcgggggcgcgccggacatcctcgcc
atccctgtcgggaacgccgggaacatcagcgcctactggatgggtttccaggaatacgcg
gccgcaggtcggagcagcaccacgccgaaaatgtggggcttccaggcggaaggcgccgcg
ccgttcattcgcggcgccatcgtggacgaaccggaaaccatcgccacggccatccgcatc
ggcaaccccgccagcgcgcacctcgcccgcgccgccgtgcaagaaagcgccgggcgcttc
gacatggcgagcgacgacgagatcatgcacgcctacaacctaattgcgcgcgagggcgtg
ttctgcgaaccggccagcgcgacgcccgtcgcgggcctcctgaagctccacgcgcagggc
gagctgccccccgggcagacggtcgtggccgtgctcaccgggaacggcctgaaagacccg
aacgccgcgctgcgctccgtggaagcgcccaaaggcgtcgaagcgaacatggaccgcgtg
ctggaagccatcctgtga

DBGET integrated database retrieval system