KEGG   Deinococcus maricopensis: Deima_0562Help
Entry
Deima_0562        CDS       T01412                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00220  Arginine biosynthesis
dmr00330  Arginine and proline metabolism
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01130  Biosynthesis of antibiotics
dmr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Deima_0562
   00330 Arginine and proline metabolism
    Deima_0562
Enzymes [BR:dmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Deima_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADV66221
UniProt: E8U582
Position
complement(652456..653340)
Genome map
AA seq 294 aa AA seqDB search
MNISLLGIPMDLGAGRRGVDMGPSALRNARLAHHLRDLGHTVTDLGDVPVAIPETADKLS
QQGLVFLDSILDACTGAYDRLRALPDDTFSISMGGDHSMSMGTVPGAARGKRTGVIWVDA
HTDFNTPDSSPSGNIHGMPVAHLTGLGDARLAGIGGGWHAHPEDIVMIGIRSIDAREREL
IREHGITVYTMKEVDQLGITRIAEETLERLFGVERLHVSFDADALDPTVCPGVGTPVPGG
LTYREGHLLMELLSESQRVTSMDIVEVNPILDVRNETAQVMVGMAASLLGQRIL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctcgcttctcggcatcccgatggacctcggcgccggccgccgcggcgtcgac
atgggccccagcgccctacgcaacgcgcgcctcgcccaccacctccgcgacctcggccac
accgtcacggacctcggcgacgtccccgtcgccatccccgaaaccgccgacaaactctcc
cagcagggcctggtgttcctcgacagcatcctcgacgcctgcaccggcgcgtacgaccgc
ctgcgcgccctccccgacgacaccttcagcatcagcatgggcggcgaccacagcatgagc
atgggcaccgtccccggcgccgcgcgcggcaaacgcaccggtgtcatctgggtcgacgcg
cacaccgacttcaacacgcccgacagcagccccagcggcaacattcacggcatgcctgtc
gcgcacctcaccggccttggcgacgcccgcctcgccggcatcggcggcggctggcacgcc
caccccgaagacatcgtcatgatcggcatccgcagcatcgacgcccgcgaacgcgaactg
atccgcgagcacggcatcaccgtctacaccatgaaagaagttgaccagctcggcatcacc
cgcatcgccgaggaaaccctggagcgcctgttcggcgtcgaacgcctccacgtctccttc
gacgcggacgccctcgacccgaccgtctgcccgggtgtcggcacgcccgtccccggcggc
ctcacttaccgcgaaggccacctgctcatggaactcctcagcgaatcccagcgcgtcacc
agcatggacattgtggaagtcaatcccatcctcgacgtccgcaacgaaaccgcgcaggtc
atggtcggcatggccgccagcctgctcggccaacggatcctgtaa

DBGET integrated database retrieval system