KEGG   Deinococcus maricopensis: Deima_0676Help
Entry
Deima_0676        CDS       T01412                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dmr  Deinococcus maricopensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Deima_0676
Enzymes [BR:dmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Deima_0676
Exosome [BR:dmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deima_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
766747..768258
Genome map
AA seq 503 aa AA seqDB search
MSQLSQEQFILALDQGTTSSRAIVFDRTGNIRATAQKEFRQIFPQPGWVEHDATEIWSTQ
IGVAQEALAKAGLRASNVAGIGITNQRETVVVWDRKTGQPIHHAIVWQDRRTAAYCDELR
DAGHEQTIREKTGLLIDAYFSGTKLKWILDHVDGARERAARGELAFGTVDSWLVFNLTGG
HLHITDATNASRTLLYNIHTGDWDDDLLRLLDVPREVLPEVRGSSEVYGETAEGLFGTRI
KVAGIAGDQQAATFGQACLERGMAKNTYGTGCFMLMNTAGEAVPSQNKLLTTVAWQLGGE
RTYALEGSVFVAGAVVQWLRDGLKIIRSSSEVEALASSVASSEGVFLVPAFVGLGAPYWD
SYARGTMVGLTRGTTAAHIARAALEAIAYQSAEVLQAMEHDSGAALKELRVDGGASTNNT
LMQFQADVLGVQVVRPKVTETTALGAAYLAGLAVGYWSSTEEITTQWAEDRCFEPQMTAD
ERSARMAKWRRAVERARDWDREL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctcagccaggaacagttcatcctcgccctcgaccagggcaccaccagcagc
cgcgccatcgtcttcgaccgcaccgggaacatccgcgcgaccgcgcagaaggaattccgt
cagatcttcccgcagcccggctgggtggagcacgacgccaccgaaatctggagcacccag
atcggcgtggcgcaggaagcgctcgccaaagcgggcctgcgcgccagcaacgtcgccggc
atcggcatcaccaaccagcgcgaaacggtcgtcgtgtgggaccgcaagactggccagccc
atccaccacgccatcgtgtggcaggaccgccgcaccgccgcgtactgcgacgagctgcgc
gacgccggacacgagcagaccatccgcgagaagaccggcctgctgatcgacgcgtacttc
agcggcaccaaactcaagtggatcctcgaccacgtggacggcgcgcgtgaacgcgccgcg
cgcggcgaactcgcgttcggcacggtggactcctggctggtgttcaacctcaccggcgga
cacctgcacatcacggacgccaccaacgccagccgcacgctgctctacaacatccacacc
ggcgactgggacgacgacctgctgcgcctgctggacgtgccccgcgaggtcctgccggag
gtgcgcggcagcagcgaggtgtacggcgagaccgccgaagggctgttcggcacgcgcatc
aaggtcgccgggattgccggggaccagcaggccgcgacgttcgggcaggcgtgcctggag
cgcggcatggcgaaaaacacctacggcaccggctgcttcatgctgatgaacaccgccggg
gaggccgtgccgagccagaacaagctgctgaccaccgtcgcgtggcagctgggcggcgag
cgcacgtacgcgctggaaggcagcgtgttcgtggcgggcgcggtggtgcagtggctgcgc
gacggcctgaagatcatccgcagcagcagcgaggtcgaagcgctcgccagcagcgtggcg
agcagcgagggcgtgttcctggtgccggcgttcgtggggctgggcgcgccgtactgggac
agctacgcgcgcggcaccatggtgggcctgacgcgcggcacgaccgccgcgcacatcgcg
cgcgcggcgctggaagccatcgcgtaccagtcggcggaggtgctgcaggccatggagcac
gattccggcgcggccctgaaggaactgcgcgtggacggcggcgccagcaccaacaacacg
ctgatgcagttccaagcggacgtgctgggcgtgcaggtcgtgcggccgaaggtcacggag
acgacggcgctgggcgcggcgtacctggcgggcctggcggtggggtactggagcagcacc
gaggagatcacgacgcagtgggcggaggaccggtgcttcgagccgcagatgactgcggac
gagcgcagcgcgcgcatggcgaagtggcgccgcgcggtggagcgcgcgcgcgactgggac
cgcgagctgtaa

DBGET integrated database retrieval system