KEGG   Deinococcus maricopensis: Deima_0940Help
Entry
Deima_0940        CDS       T01412                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dmr  Deinococcus maricopensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dmr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1031491..1031991
Genome map
AA seq 166 aa AA seqDB search
MTAPVDALIALGANLGDPRANLAWAVRELAGVGVVTGVSRVYRTAPVGGPPGQPDYLNAA
ARLRTTLTPHDVLAALLDIERRSGRERRERWGPRVLDLDLIAYGDLSLDTDDLTLPHPRA
WTRAFVLAPLHDVAPDYAHPGTGERVRDALARVGLHGVHAERDPLR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcccgtggacgcgctgatcgccctcggcgcgaacctcggcgacccccgcgcg
aacctcgcgtgggccgtgcgggaactcgcgggcgtcggcgtcgtcaccggcgtgtcccgc
gtgtaccgcaccgcgcccgtcggcggcccgcccggccagccggactacctgaacgccgcc
gcgcgcctccgcacgacgctcaccccgcacgacgtcctcgcagcgctgctcgacatcgaa
cgccgttccggccgcgaacgccgcgaacgctggggcccgcgcgtcctcgacctcgacctg
atcgcgtacggtgacctcagcctcgacacggacgacctgacgctcccgcacccacgcgcg
tggacgcgcgcgttcgtccttgcccccctgcacgacgtcgcgcccgactacgcgcacccc
ggcaccggcgagcgcgtccgcgacgcgctcgcgcgcgtcggcctgcacggcgtccacgcg
gaacgcgacccgctgcgctga

DBGET integrated database retrieval system