KEGG   Deinococcus maricopensis: Deima_0994Help
Entry
Deima_0994        CDS       T01412                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dmr  Deinococcus maricopensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deima_0994
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deima_0994
   00020 Citrate cycle (TCA cycle)
    Deima_0994
   00620 Pyruvate metabolism
    Deima_0994
Enzymes [BR:dmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Deima_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1102665..1104092)
Genome map
AA seq 475 aa AA seqDB search
MATEVKLPDVGDNIEQGTVVTILVKAGDTVTEGQPIIEIETDKAVVEVPSSAAGTVAEVK
VKEGDTVKIGGTILTLSGGAGGNVPSDTNLGAGRSDALGVVGQGGETDEATTVAPNAGTA
ERVAQAQAESQKQQASSPAPTPAQAPATTRAPQLFDGRNVVHAAPSVRRLARELGVNIQT
VQGSGVAGRISEDDVRRAVSGAPASTPAPAQAAAPVAPQAAMPVAAPTPASPVPPLPNFE
KWGAVRREDMSGVRKATVRSMTQSWTTIPMVTHFDKADVTRMEEVRKQFGARVEKAGGKL
TMTHILMKVVANALRKFPKFGASLDLPNQQVVYKDYVNLGVAVDTPNGLLVPVLKDVDRM
SITEIVLGLTDLANKARERKLKPDEMQGATFTISNLGGIGGHAFTPIVNSPEVAILGVSR
GGFEPVWNKEKGEFEPRNMLPISLSYDHRLIDGADAARFVRFICESLEDPFLISL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagaagtgaaactccccgacgtgggggacaacatcgagcagggcacggtcgtg
acgatcctcgtgaaggccggcgacaccgtcaccgaaggtcagcccatcatcgagatcgaa
accgacaaggccgtcgtggaggtgcccagcagcgccgccggcacggtcgctgaagtcaag
gtcaaggagggcgacaccgtcaagatcggcggcaccatcctcaccctcagcggcggcgcg
ggcgggaacgtccccagtgacacgaacctcggcgcgggccgcagcgacgcgctcggcgtg
gtcggccagggcggcgagacagacgaggcgacgacggtcgcgccgaacgccggcacggcc
gagcgcgtcgcgcaggcgcaggccgagtcgcagaagcagcaggccagcagccccgccccc
acgcccgcccaggccccggccacgacgcgcgcgccgcagctgttcgacggccgcaacgtc
gtgcacgccgcgccgagcgtccgccgcctcgcccgtgaactgggcgtgaacatccagacg
gtgcagggcagcggcgtcgcgggccgcatcagcgaggacgacgtgcgccgcgccgtgagt
ggcgcgcccgcgagtacgccggcgcccgctcaggccgctgcaccggtcgcgccgcaggcg
gccatgccggtcgcggcgcccacgccggcctcgcccgtgccgcccctccccaacttcgag
aagtggggcgcggtgcgccgcgaggacatgagcggcgttcgcaaggccaccgtgcgcagc
atgacgcagtcgtggacgaccatcccgatggtcacgcacttcgacaaggccgacgtgacc
cgcatggaagaggtccgcaagcagttcggcgcgcgcgtcgagaaggccggcgggaagctc
accatgacgcacatcctgatgaaggtcgtcgcgaacgccctgcggaagttcccgaagttc
ggcgcgagcctggacctgccgaaccagcaggtcgtgtacaaggactacgtgaacctcggc
gtggctgtggacaccccgaatggcctgctcgtgcccgtcctgaaggacgtggaccgcatg
agcatcaccgagatcgtcctgggcctcacggacctcgcgaacaaggcgcgcgagcggaaa
ctcaagccggacgagatgcagggcgcgacgttcaccatctcgaacctcggtgggattggc
gggcacgcgttcacgcccatcgtgaacagcccggaagtggcgatcctcggcgtgagccgc
ggcgggttcgagcctgtgtggaacaaggagaaaggcgagtttgagccgcgcaacatgctg
ccgatcagcctgtcgtacgaccaccgcctcatcgacggcgcggacgcggcgcgcttcgtg
cgcttcatctgcgagagcctcgaagatccgttcctgatcagcctgtaa

DBGET integrated database retrieval system