KEGG   Deinococcus maricopensis: Deima_1096Help
Entry
Deima_1096        CDS       T01412                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dmr  Deinococcus maricopensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Deima_1096
Enzymes [BR:dmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Deima_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199963..1200844
Genome map
AA seq 293 aa AA seqDB search
MSVLVVGSVNADLIVRAPHIPAPGETVLGGDAIALPGGKGANQAVACARAGAHVHFCGAV
GHDAFAAIATANLRADGVNLDALHTLDAPTGLALITVSAEGENAITVASGANAHMTPGHL
PDLHGTDVLLLQLELPLSVVEAAAQQAKRAGAHVLLNAAPARTLPAELLQHIDTLILNEG
ELTAVAGAGSTETQARALLSRGPHTVIVTLGGDGSLAVTADGTHQQAALPVNVVDTTGAG
DTFCGAFAAALASGQPLPDALRFANVAGALATTQLGAQAAMPTHAEIQAHLST
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcctggtcgtcggcagcgtcaacgcggacctgatcgtgcgcgccccgcacatc
cccgcgcccggcgaaaccgtcctcggcggcgacgccatcgccctgcccggcgggaagggc
gccaaccaggcggtcgcgtgcgcccgcgcgggcgcgcacgtgcacttctgcggcgcggtc
ggccatgacgccttcgcggccatcgccacggcgaacctccgcgcggacggcgtgaacctg
gacgccctccacaccctggacgcccccaccggcctcgccctcatcaccgtatctgcagaa
ggcgagaacgccatcacagtggcgagcggcgcgaacgcccacatgacgcccggccacctc
ccggacctccacggcacggacgtgctgctcctgcaactggaactgcccctgagcgtcgtc
gaggcagccgcgcagcaggcgaaacgcgcgggcgcgcacgtcctcctgaacgccgcgccc
gcccgcaccctccccgccgagctgctgcagcacatcgacacgctcatcctgaacgagggc
gaactgaccgccgtggccggcgccggctccaccgaaacgcaggcccgggcgctgctgagc
cgcggcccccacaccgtcatcgtcacgctcggcggtgacggcagcctcgcggtcaccgcc
gacgggacccaccaacaggcagccctccccgtgaacgtcgtggacaccaccggcgcaggc
gacaccttctgcggtgctttcgctgcggccctggcatccggacagcccctcccggacgcg
ctgcgtttcgccaacgtcgcgggggcgcttgccaccacgcaactgggcgcgcaggccgcc
atgcccacacacgccgaaattcaggcccacctgagcacgtaa

DBGET integrated database retrieval system