KEGG   Deinococcus maricopensis: Deima_1262Help
Entry
Deima_1262        CDS       T01412                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00630  Glyoxylate and dicarboxylate metabolism
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01200  Carbon metabolism
Module
dmr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Deima_1262
Enzymes [BR:dmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Deima_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADV66913
UniProt: E8U774
Position
complement(1369761..1371056)
Genome map
AA seq 431 aa AA seqDB search
MTQTPRTHAEILEKTWMTESRWQGIQRNYSAEDVVKLRGSLHIEHTLAKRGAEKLWRLMR
EEPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANNAGQMYPDQSLYPASSVPDVV
RRINATLRRADQIHHAEGDDSIDWFAPIVADAEAGFGGPLNAFELMKAMIEAGAAGVHFE
DQLASEKKCGHLGGKVLVPTSQFIRTLNAARLAADVQGVPTVLIARTDADAANLLTADID
ENDRPFLTGERTPEGFFYVRPGIEQAISRALAYAPYADVLWCETSVPNLEDARRFAEAVH
AQYPGKLLAYNCSPSFNWRKNLDDATIARFQRELGELGYKFQFITLAGFHSLNYGMFDLA
YGYARNQMTSFVELQEREFAAQERGFTAVKHQREVGTGYFDLVATAAGGGHSSTTALAGS
TEAQQFALSHD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagacgccccgtacgcacgccgagatcctcgaaaagacctggatgaccgaaagt
cgctggcagggcattcagcgcaattacagcgccgaagacgtcgtgaagctgcgcggcagc
ctgcacatcgagcacaccctcgccaagcgtggcgcggagaagctgtggcgcctgatgcgc
gaggagccgttcgtgaacgccctcggcgcgctcaccggcaaccaggcgatgcagcaggtg
aaggcgggcctgaaggccatctacctgagtggctggcaggtcgcggcggacgcgaacaac
gccgggcagatgtacccggaccagagcctgtacccggcgagcagcgtcccggacgtcgtg
cggcgcatcaacgccacgctgcgccgcgcggaccagattcatcacgccgaaggggacgac
agcattgactggttcgcgccgatcgtcgcggacgccgaagcaggcttcgggggccccctg
aacgcgttcgagctgatgaaggccatgattgaggcgggcgcggcgggcgtacacttcgag
gaccagctcgccagtgagaagaaatgcgggcacctgggcgggaaggtgctcgtgccgacc
agccagttcatccgcaccctgaacgccgcgcgcctcgccgcggacgtgcagggcgtccca
acggtgctgatcgcccgcacggacgcggacgccgcgaacctcctcacggcggacatcgac
gagaacgaccggccgttcctgacaggtgagcgtacgcccgaggggttcttctacgtgcgg
ccgggcattgagcaggcgatcagccgcgccctcgcgtacgcgccgtacgcggacgtgctg
tggtgcgaaacgagcgtcccgaacctggaggacgcccgccggttcgcggaggcggtgcac
gcgcagtacccgggcaagctcctcgcgtacaactgcagccccagcttcaactggcgcaag
aacctggacgacgcgaccatcgcgcggttccagcgggaactgggcgagttggggtacaag
ttccagttcatcacgctcgccggcttccacagcctgaattacggcatgttcgacctggcg
tacgggtatgcccgcaaccagatgaccagcttcgtggagttgcaggagcgggagttcgcg
gcgcaggagcgtgggttcacggctgtgaagcatcagcgggaggtcggcaccgggtacttc
gacctcgtggcgacggcggcgggcggcgggcacagcagcacgaccgcgctcgcgggcagc
accgaggcgcagcagttcgcgttgtcgcacgactga

DBGET integrated database retrieval system