KEGG   Deinococcus maricopensis: Deima_1263Help
Entry
Deima_1263        CDS       T01412                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
dmr  Deinococcus maricopensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deima_1263
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deima_1263
   00630 Glyoxylate and dicarboxylate metabolism
    Deima_1263
Enzymes [BR:dmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Deima_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1371187..1372758)
Genome map
AA seq 523 aa AA seqDB search
MTQTQTITTTAHPLAARVLTPDALEFLTALEARFGTRRRHLLDARQERQTRLDAGETPDF
LAATRGVREGQWRINPLPQDLQDRRVEITGPVDRKMIINALNSGANVFMADFEDASSPTW
DNCVQGQVNLQDAVRRTITLDAGGKTYRLNDQVATLIVRPRGLHLDEKHATLGGQPVSGS
LFDFGLYFFHNARELLARGSGPYVYLPKLEGHLEARWWNDVFEYAQDALGIPRGTIKATV
LIETILAAFEMDEILYELRAHSAGLNCGRWDYIFSYIKKFRSDPGRLLPDRAQVTMGTPM
MLAYSKLAVQTCHKRGAPAIGGMSAFIPVKNDRAANERAFAQVRADKEREATNGHDGTWV
AHPGMVALAREVFDRLMPEPNQIGSGKQADLTVTALDLLTPPEGSVTAAGVNTNVDVSLQ
YLAAWLDGRGAVPIHNLMEDAATAEISRAQLWQWARYDVRTDDGTPITPDGLTRLVDQHL
ARLQAEQPERAARLAEAAELLKPLITSDTFEEFLTLPGYARLQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaacgcagaccatcaccaccaccgcgcaccccctcgcggcccgcgtgctcacg
ccggacgcgctggaattcctcacagcgctcgaagcgcgtttcggcacgcgccgccgccac
ctgctcgacgcgcgccaggaacgtcagacgcgcctggacgccggtgaaacgccggatttc
ctggccgccacgcgcggcgtccgcgaggggcagtggcgcatcaacccacttccgcaggac
ctgcaggaccgccgcgtggaaatcaccgggcccgtggaccgcaagatgatcatcaacgcg
ctgaacagcggcgcgaacgtgttcatggcggacttcgaggatgccagcagtcccacctgg
gacaactgcgtgcaggggcaggtgaacttgcaggacgccgtgcgccgcaccatcaccctg
gacgccggcggcaaaacgtaccgcctgaacgaccaggtcgccacgttgatcgttcgcccg
cgtggcctgcacctcgacgagaagcacgccacgctcggcggtcagccggtgagcggcagc
ctgttcgacttcgggctgtacttcttccataacgcccgcgagctgctggcgcgcggcagc
gggccgtacgtctacctaccgaagctggaggggcacctggaggcgcggtggtggaatgac
gtgttcgagtacgcgcaggacgcgctcggcattccgcgcgggaccatcaaggcgaccgtg
ctgatcgagacgatcctcgcggcgttcgagatggacgagatcctgtacgagctgcgtgcg
cactccgccggcctgaactgcggccgttgggattacatcttcagttacatcaagaagttc
cggagtgatccgggcaggctcctgccggaccgcgcgcaggtcacgatgggcacgcccatg
atgctcgcgtacagcaaactggcggtgcagacgtgccacaagcgcggcgcgcccgccatt
ggcggcatgagcgcgttcattcccgtgaagaacgaccgagccgcgaacgagcgcgcgttc
gcgcaggtgcgtgcggacaaggagcgggaggcgacgaacgggcacgacggcacgtgggtg
gcgcacccgggtatggtcgcgctggcccgtgaggtgttcgaccgcctgatgcccgagccg
aaccagatcggcagcggcaagcaggcggacctgaccgtgacggctcttgacctgctgacg
ccgccggaagggtcggtcacggcagcgggcgtgaacacgaacgtggacgtgagcctgcag
tatctcgcagcgtggctggacgggcgcggcgccgtccccatccacaacctgatggaggac
gccgccaccgcggaaatcagccgcgcgcagttgtggcagtgggcgcggtacgacgtccgc
acggacgacggcacgcccatcacgccggacggcctgacgcgcctcgtggatcagcacctc
gcgcgcctgcaggcggagcagccggagcgggccgcgcgcctcgcggaggccgcggagctc
ctgaagccgctgatcacgagtgacacgttcgaggagttcctgacgctgcccggatacgca
cgcctccagtga

DBGET integrated database retrieval system