KEGG   Deinococcus maricopensis: Deima_1301Help
Entry
Deima_1301        CDS       T01412                                 

Definition
succinate dehydrogenase cytochrome subunit B
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
dmr  Deinococcus maricopensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:dmr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dmr00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dmr00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:dmr00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1411856..1412239)
Genome map
AA seq 127 aa AA seqDB search
MLRAKTYQDAKMASHTNAELNWWIFMRISGVLLVFLVLGHVYMTFIQVSESDATFDAVVN
KLAQPAWKFYDFLILLLATLHGVNGARYSIEDYIRSRPNRFWVKGVFYTVVASIFTLGTI
GLFTYHA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgcgaaaacgtatcaggacgcgaaaatggcgtcgcacacgaacgccgagctg
aactggtggatcttcatgcgcatcagcggcgtgctgctggtgttcctggtgctggggcac
gtgtacatgaccttcattcaggtcagcgagagcgacgcgaccttcgacgcggtcgtgaac
aagctcgcgcagcccgcctggaagttctacgacttcctgatcctgctgctcgccacgctg
cacggcgtgaacggcgcgcgctacagcatcgaggattacatccgctcccgcccgaaccgg
ttctgggtgaaaggcgtgttctacacggtcgtcgcgtcgatcttcacgctcggcaccatc
ggcctgttcacgtaccacgcgtaa

DBGET integrated database retrieval system