KEGG   Deinococcus maricopensis: Deima_1301Help
Entry
Deima_1301        CDS       T01412                                 

Definition
(GenBank) succinate dehydrogenase cytochrome b subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00020  Citrate cycle (TCA cycle)
dmr00190  Oxidative phosphorylation
dmr00650  Butanoate metabolism
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01130  Biosynthesis of antibiotics
dmr01200  Carbon metabolism
Module
dmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dmr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deima_1301
   00650 Butanoate metabolism
    Deima_1301
  Energy metabolism
   00190 Oxidative phosphorylation
    Deima_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS VirB8
Motif
Other DBs
NCBI-ProteinID: ADV66952
UniProt: E8U7B3
Position
complement(1411856..1412239)
Genome map
AA seq 127 aa AA seqDB search
MLRAKTYQDAKMASHTNAELNWWIFMRISGVLLVFLVLGHVYMTFIQVSESDATFDAVVN
KLAQPAWKFYDFLILLLATLHGVNGARYSIEDYIRSRPNRFWVKGVFYTVVASIFTLGTI
GLFTYHA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgcgaaaacgtatcaggacgcgaaaatggcgtcgcacacgaacgccgagctg
aactggtggatcttcatgcgcatcagcggcgtgctgctggtgttcctggtgctggggcac
gtgtacatgaccttcattcaggtcagcgagagcgacgcgaccttcgacgcggtcgtgaac
aagctcgcgcagcccgcctggaagttctacgacttcctgatcctgctgctcgccacgctg
cacggcgtgaacggcgcgcgctacagcatcgaggattacatccgctcccgcccgaaccgg
ttctgggtgaaaggcgtgttctacacggtcgtcgcgtcgatcttcacgctcggcaccatc
ggcctgttcacgtaccacgcgtaa

DBGET integrated database retrieval system