KEGG   Deinococcus maricopensis: Deima_1301Help
Entry
Deima_1301        CDS       T01412                                 

Definition
succinate dehydrogenase cytochrome subunit B
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
dmr  Deinococcus maricopensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deima_1301
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deima_1301
   00650 Butanoate metabolism
    Deima_1301
  Energy metabolism
   00190 Oxidative phosphorylation
    Deima_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1411856..1412239)
Genome map
AA seq 127 aa AA seqDB search
MLRAKTYQDAKMASHTNAELNWWIFMRISGVLLVFLVLGHVYMTFIQVSESDATFDAVVN
KLAQPAWKFYDFLILLLATLHGVNGARYSIEDYIRSRPNRFWVKGVFYTVVASIFTLGTI
GLFTYHA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgcgaaaacgtatcaggacgcgaaaatggcgtcgcacacgaacgccgagctg
aactggtggatcttcatgcgcatcagcggcgtgctgctggtgttcctggtgctggggcac
gtgtacatgaccttcattcaggtcagcgagagcgacgcgaccttcgacgcggtcgtgaac
aagctcgcgcagcccgcctggaagttctacgacttcctgatcctgctgctcgccacgctg
cacggcgtgaacggcgcgcgctacagcatcgaggattacatccgctcccgcccgaaccgg
ttctgggtgaaaggcgtgttctacacggtcgtcgcgtcgatcttcacgctcggcaccatc
ggcctgttcacgtaccacgcgtaa

DBGET integrated database retrieval system