KEGG   Deinococcus maricopensis: Deima_1628Help
Entry
Deima_1628        CDS       T01412                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dmr  Deinococcus maricopensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Deima_1628
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Deima_1628
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Deima_1628
Enzymes [BR:dmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Deima_1628
Exosome [BR:dmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deima_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1755179..1756918
Genome map
AA seq 579 aa AA seqDB search
MKPFLTLLTATLALSGLASAADLKIYPYDGAHVLAGQRFDLRVEAGSVKGAGDATVTLDG
QPVGNLVRSSAGDGKAEWTLRGTSLPSGNHTLQVTFKDDSGTSTAQAAWTADAPTTGPAK
KVILFIGDGMGWNTVRAAELIAKGYNPANGMPRGRLAMEEGLGGMATVTTSSYDSFLADS
ANTASSIASGQKIAVNALNVYPDNTPDTLDNPRIETITEILKRTRGAGVGLVTNAYGADA
TPAAFGAHTFKRGDYAAIVDQYFKGAASPDVLLMGGSRDFIPQSAPGSRRKDNTDWITDS
QKLGFTLATTRAELNAAKGSKLLGLFNYDNLNYYLDRAQYQDPKVLGDFKDQPYLWEMTQ
KAVATLDQNPNGYFLMVEGGLIDKAEHPLDWQRGVFDVLELDKAVAWAKDYARTHPDTLV
LVTADHAHSISTFGGYDTTMGAGNREAVGTYQDAKFPTYGDKLDANGIPMVNTPRTLAVG
FAATPDYCETFVSRSVFKDPSVSDGQGGYVPNPDICGETGAYFRIGNLPKSANQGVHTAD
PLPLFAFGAGAGNFMGLMDQTDIFFQIARAMGVDATKTK
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgttcctcaccctgctcaccgcaaccctcgccctcagtggcctcgcgagtgcc
gccgacctcaaaatctacccgtacgacggcgcgcatgtcctcgccggccagcgcttcgac
ctgcgcgtcgaagcgggcagcgtcaaaggcgccggggacgccaccgtcaccctcgacggc
cagcccgtcgggaacctcgtgcgcagcagcgccggcgacggcaaagcggaatggaccctg
cgcggcaccagcctccccagcggcaaccacaccctccaggtgaccttcaaggacgacagc
ggcaccagcaccgcccaggccgcctggaccgccgacgcgcccaccaccggccccgccaag
aaagtcatcttgttcatcggggacggcatgggctggaacaccgtccgcgccgccgaactc
atcgccaagggctacaaccccgccaacggcatgccccgcgggcgcctcgccatggaagaa
ggcctgggcggcatggcgaccgtcacgaccagcagctacgacagcttcctcgcggacagc
gccaacacggcgtccagcatcgccagcggccagaagatcgctgtgaacgccctgaacgtc
tacccggacaacacccccgacacgctcgacaacccccgcatcgagaccatcaccgaaatc
ctcaagcgcacccgcggcgccggcgtcggcctcgtcaccaacgcgtacggcgcggacgcc
acgcccgccgcgttcggcgcgcacaccttcaagcgcggcgactacgccgccatcgtcgac
cagtacttcaagggcgccgccagccccgacgtgctcctgatgggcggcagccgcgacttc
attccgcagagcgcccccggctcccgccgcaaggacaacaccgactggatcaccgacagc
cagaagctcggcttcacgctcgccaccacccgcgcggaactgaacgccgcgaagggcagc
aaactcctcggcctgttcaactacgacaacctcaactactacctcgaccgcgcgcagtac
caggaccccaaagtcctcggggacttcaaggaccagccgtacctctgggagatgacccag
aaggccgtcgccacccttgaccagaaccccaacggctacttcctgatggtcgaaggcggc
ctgatcgacaaagccgaacaccccctcgactggcagcgcggcgtgttcgacgtcctcgaa
ctcgacaaggccgtcgcgtgggccaaggattacgcccgcacgcaccccgacacgctcgtg
ctcgtgaccgctgaccacgcgcactccatcagcaccttcggcgggtacgacaccaccatg
ggcgccggcaaccgcgaagcggtcggcacctaccaggacgccaagttccccacgtacggc
gacaagctcgacgcgaacggcatccccatggtgaacaccccccgcacgctcgcggtcggc
ttcgccgccacgcccgactactgcgagaccttcgtgagccgcagcgtcttcaaggacccg
tccgtcagcgacggccagggcggctacgtccccaaccccgatatctgcggtgaaaccggc
gcgtatttccgcatcggcaacctccccaagagcgcgaaccagggcgtccacaccgccgac
cccctgccgctcttcgcgttcggcgcgggcgccggcaacttcatgggcctgatggaccag
accgacatcttcttccagattgcgcgcgccatgggcgtcgacgccaccaaaaccaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system