KEGG   Deinococcus maricopensis: Deima_1678Help
Entry
Deima_1678        CDS       T01412                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dmr  Deinococcus maricopensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deima_1678
Enzymes [BR:dmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Deima_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1809829..1811340
Genome map
AA seq 503 aa AA seqDB search
MTITRSSGVLLHPTSLPGPYGIGELGDAAYAFVDWLARAGQAYWQVMPLGPTGYGDSPYQ
SFSAFAGNPYLISLDALRKHDLLLAADFDAAPAFDAAHVDFGLQYIWRNQMLDRAFAHFE
SGRGAHLKADLDTFVNAERAWLDDYALYTAIKAEQGGLPWNAWPEALRTRDAQALTDARQ
RLERDIRRVQFTQFLFFRQWNTLRRYAHERGIQIIGDIPIFVAMDSADAWANPEQFLFDE
SGQPTVVAGVPPDYFSETGQLWGNPLYRWDAMQADGFQWWINRFRGSLNLYDIIRIDHFR
GFAAAWQIPYPAENAIQGAWVPSPGHALFHAVKGALGDFPIIAEDLGVVTPDVEQLRDDF
AFPGMAVLQFAFAGGDFSVNAFLPHNLRQNQVVYTGTHDNDTTRGWWATATQDEKHNLGT
YLGRYVDDATIAWTLTEVAFESRANLAVVPLQDLMNLGTEARMNLPGTLGPHNWTWRYAP
GALTPDLADRLQALTTRTERRHP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcacacgctccagcggcgtcctgctgcacccaaccagcctgcccggcccctac
ggcatcggcgaactcggcgacgccgcctacgccttcgtcgactggctcgcccgcgccgga
caggcgtactggcaggtcatgcccctcggtcccaccggctacggcgacagcccctaccag
tccttcagcgccttcgccggcaacccctacctcatcagcctcgacgccctgcgcaaacac
gacctgctgctcgctgccgacttcgacgccgcccccgccttcgacgccgcgcacgtcgac
ttcggtctgcagtacatctggcgcaaccagatgctcgaccgcgccttcgcgcacttcgaa
agcggacgcggcgcgcacctcaaagccgacctcgacaccttcgtgaacgcggaacgcgcc
tggctcgacgactacgccctgtacaccgccatcaaggccgaacagggcggcctcccctgg
aacgcctggcccgaagcgctccgcacccgcgacgcccaggccctcactgacgcccgccag
cgcctcgaacgtgacatccgccgcgtgcagttcacgcagttcctgttcttccgacagtgg
aacaccctgcgccgctacgcccacgaacgcggcatccagatcatcggggacatccccatc
ttcgtcgccatggacagcgccgacgcctgggcgaaccccgaacagttcctgttcgacgaa
agtggccaacccaccgtcgtcgccggcgtcccacccgactacttcagcgaaaccgggcag
ctctggggcaatcccctgtaccgctgggacgccatgcaggccgacggcttccaatggtgg
atcaaccgcttccgcggcagcctgaacctctacgacatcatccgcatcgaccacttccgt
ggattcgcggccgcctggcagattccctaccccgccgagaacgccatccagggcgcgtgg
gtgccgtcccccgggcacgccctgttccacgccgtgaagggcgccctcggggacttcccg
atcatcgccgaggacctcggcgtcgtcacgcccgacgtcgagcagctgcgcgacgacttc
gcctttcccggcatggccgtcctgcagttcgcgttcgccggcggtgacttcagcgtgaac
gccttcctgccgcacaacctccgccagaaccaggtcgtgtacaccggcacgcacgacaac
gacaccacgcgcggctggtgggcaaccgccacgcaggacgaaaagcacaacctcggcacg
tacctcggccggtacgtggacgacgccaccatcgcgtggacgctcaccgaggtcgcgttc
gagagtcgcgcgaacctcgctgtcgtgcccctgcaggacctcatgaacctcggcaccgag
gcgcgcatgaacctccctggcacgctcggcccgcacaactggacgtggcgctacgcgccc
ggcgcgctcacgcccgacctcgccgaccgcctgcaggccctcacgacccgcaccgaacgc
cgccacccgtaa

DBGET integrated database retrieval system