KEGG   Deinococcus maricopensis: Deima_1849Help
Entry
Deima_1849        CDS       T01412                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dmr  Deinococcus maricopensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deima_1849
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deima_1849
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deima_1849
Enzymes [BR:dmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deima_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1990592..1991395)
Genome map
AA seq 267 aa AA seqDB search
MTVTQTRTERIHAAFDRARTEGRAAFIPFLTAGYPNAAGFHAVARALLDRADLMEVGLPY
SDPLGDGPVIQRASEQVLREGSSTLRTFEYVRALRAESSTPILLMTYINPVYAVGPERFM
RLAVEAGVDGLILPDLPPDQDEEIQALARQAGLALTFLIAPTSTPERVALVTRACTGFVY
AVSVTGVTGAREGSALGEVPALVALARQHTSLPVAVGFGVKDAATARAVAVDAGADGVVV
GSAFIQAIERGEDAAALADAIRSGTRK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcacgcagacccgcacggaacggattcacgccgcgttcgaccgcgcgcgcacc
gagggccgcgccgcgttcatcccgttcctcacggccggctacccgaacgctgcgggcttc
cacgcggtcgcgcgcgcgctgctggaccgcgctgacctgatggaggtgggcctgccgtac
agcgacccgctcggcgacggtccggtcatccagcgcgccagcgagcaggtcctgcgcgag
ggcagcagcaccctgcgcaccttcgagtacgtgcgcgcgctccgcgccgagtcgagcacg
cccatcctgctcatgacgtacatcaatcccgtgtacgccgtcggcccggaacgcttcatg
cgcctcgccgtggaggccggcgtggacggcctgatcctcccggacctgccgcccgaccag
gacgaggagattcaggcgctcgcccgtcaggcgggcctggccctgacgtttctgatcgcg
ccgaccagcacgccggagcgtgtggcgctggtcacgcgcgcgtgcacggggttcgtgtac
gccgtgagcgtgacgggcgtgacgggcgcgcgtgagggcagcgccctgggggaagtcccg
gcgcttgtcgcgctcgcgcggcagcatacgtccctgcccgtcgcggtggggttcggcgtg
aaggacgccgcgacggcccgcgcggtcgccgtggacgccggcgcggacggcgtggtcgtc
ggcagtgccttcattcaggccatcgagcgcggcgaggacgccgccgccctcgcggacgcc
atccgcagcggcacccgcaagtaa

DBGET integrated database retrieval system