KEGG   Deinococcus maricopensis: Deima_1850Help
Entry
Deima_1850        CDS       T01412                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dmr  Deinococcus maricopensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deima_1850
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deima_1850
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deima_1850
Enzymes [BR:dmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deima_1850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1991392..1992621)
Genome map
AA seq 409 aa AA seqDB search
MSLPTYPQPDARGRYGRFGGRYVPETLIPALDELERAYTEAKNDPEYLRELAYYLGDFVG
RESPLYYAENLTRHAGGAKIYLKREDLNHTGAHKINNCVGQALLARRMGKQRIIAETGAG
QHGVATATACALLGLQCVVYMGAEDIRRQALNVFRMKLLGAEVREVTSGTSTLKDATNEA
IRDWVTNVRDTFYILGSVVGPHPYPAMVRDLQSVIGEEVKRQLQEKEGRSVPDAIIACVG
GGSNAIGIFAPFAYEQPRPLLIGAEAAGEGVESGRHAASVAGGKVGVLHGSMMYLLHDDE
GQILPAHSVSAGLDYPGIGPEHCWYSETGAATYVPVTDAQALDALQLLARTEGIIPALES
AHAIHQAIETARELGEGKVIVVNLSGRGDKDVVEVMRLLDGVERQEVHA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccccacgtacccccaacccgacgcgcgcggacggtacggacgcttcggcgga
cgctacgtccccgaaacgctcattcccgccctcgacgaactcgaacgcgcctacaccgaa
gccaagaacgaccccgagtacctccgcgaactcgcgtactacctcggcgacttcgtcggc
cgcgaaagccccctgtactacgccgagaacctcacccgccacgccggcggcgcaaaaatc
tacctgaagcgcgaggacctcaaccacaccggcgcgcacaagatcaacaactgcgtcggc
caggccctcctcgcccgccgcatgggcaagcagcgcatcatcgccgaaacgggcgccggg
cagcacggcgtcgccaccgccaccgcctgcgccctgctcgggttgcagtgcgtcgtgtac
atgggcgccgaggacatccgccgccaggccctcaacgtcttccgcatgaaactcctcggc
gccgaggtccgcgaggtcaccagcggcaccagcaccctcaaggacgccaccaacgaagcc
atccgcgactgggtcacgaacgtccgcgacaccttctacatcctcggcagcgtcgtcggc
ccgcacccgtaccccgccatggtccgcgacctccagagcgtcatcggcgaggaagtcaaa
cgccagctgcaggaaaaagaaggccgcagcgtcccggacgcgatcatcgcctgcgtcggc
ggcggcagcaacgccatcggtattttcgcgccgttcgcgtacgagcagccccgccccctc
ctgatcggcgcggaagcggccggtgagggcgtcgagagcggtcggcacgccgcgtccgtc
gcgggcggcaaggtcggcgtgctgcacggcagcatgatgtatctcctgcacgacgacgaa
ggccagatcctcccggcgcacagcgtcagcgccggcctcgactaccccggcatcggtccg
gagcactgctggtacagcgaaacgggcgccgccacgtacgtgcccgtcacggacgcgcag
gccctcgacgccctgcagctgctcgcgcgcaccgaaggcatcatccccgcgctcgaaagc
gcgcacgccattcaccaggccatcgaaaccgcccgtgaactcggcgagggcaaggtcatc
gtcgtgaacctcagcggccgcggcgacaaggacgtcgtcgaggtgatgcgcctcctggac
ggcgtggaacgccaggaggtgcacgcatga

DBGET integrated database retrieval system