KEGG   Deinococcus maricopensis: Deima_1999Help
Entry
Deima_1999        CDS       T01412                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00020  Citrate cycle (TCA cycle)
dmr00640  Propanoate metabolism
dmr00660  C5-Branched dibasic acid metabolism
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01130  Biosynthesis of antibiotics
dmr01200  Carbon metabolism
Module
dmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deima_1999
   00640 Propanoate metabolism
    Deima_1999
   00660 C5-Branched dibasic acid metabolism
    Deima_1999
Enzymes [BR:dmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Deima_1999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 GARS_A TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ADV67644
UniProt: E8U9A5
Position
2172241..2173386
Genome map
AA seq 381 aa AA seqDB search
MKLHEYQGKELLRRFGVNVQEGKVAHTPEEVRAIAEEYGQPVVVKAQVHVGGRGKAGGVK
FSPTADKAVENAQKILGMDIKGLTVNKVLVTKAVDIDAGVEYYVGMIVDRNVQSFTLMAC
AEGGMEIEELAAERPEAIIRHRVDPVAGLRPFEAREIALKAGFKGNLNKIADMMVKMSKA
ALELDATLVEINPLFVDADGTPLALDTKFDMDDNAVYRHKDIAAWRELEAEHPLEVEASE
YGFAYVKLDGNVGVLGNGAGIVMTSLDVVNRAGAKPANFLDIGGGARADIVYNAVKLVSK
DSDVKSIFVNIFGGITRADEVAKGIIQALQEGILTKPVRMRVAGTAEEEAKALLADVNSP
LIQMYPDMFQAAEAAAQEANK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactccacgagtaccaaggcaaagaactgctccgccgtttcggcgtgaacgttcag
gaaggcaaggtcgcgcacacccccgaggaagtgcgcgccattgctgaggaatacggccag
ccggtcgtcgtcaaggcgcaggtgcacgtcggtggccgcggcaaggccggcggcgtcaaa
ttcagccccaccgccgacaaggccgtcgagaacgcccagaagatccttggcatggacatc
aagggcctcacggtcaacaaggtcctcgtcaccaaggccgtcgacatcgacgccggcgtc
gagtactacgtcggcatgatcgtggaccgcaacgtccagtccttcacgctgatggcctgc
gccgaaggcggtatggaaatcgaggagctcgccgccgagcgccccgaagcgatcatccgt
caccgcgtggaccccgtcgcgggcctgcgccccttcgaagcgcgcgaaatcgccctcaag
gccggcttcaaaggcaacctgaacaagatcgccgacatgatggtcaagatgagcaaggcc
gcgctcgaactcgacgcgaccctcgtggagatcaacccgctgttcgtggacgccgacggc
acccccctcgcactcgacacgaagttcgacatggacgacaacgccgtgtaccgccacaag
gacatcgccgcgtggcgcgaactcgaagcggaacacccgctcgaagtggaagccagcgag
tacggcttcgcgtacgtgaagctcgacgggaacgtcggcgtgctcggcaacggcgccggc
atcgtgatgaccagcctcgacgtcgtgaaccgcgccggcgccaagcccgcgaacttcctc
gacatcggcggcggcgcccgcgccgacatcgtctacaacgccgtgaagctcgtcagcaag
gacagcgacgtgaagagcatcttcgtgaacatcttcggcggcatcacccgcgccgacgaa
gtcgcgaagggcatcatccaggcgctccaggaaggcatcctcaccaagcccgtgcgcatg
cgcgtggccggcactgccgaagaggaagccaaggcgctgctcgcggacgtgaacagcccc
ctgatccagatgtacccggatatgttccaggccgcggaggccgccgcccaggaggccaac
aaatga

DBGET integrated database retrieval system