KEGG   Deinococcus maricopensis: Deima_1999Help
Entry
Deima_1999        CDS       T01412                                 

Definition
(RefSeq) succinyl-CoA ligase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dmr  Deinococcus maricopensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deima_1999
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deima_1999
   00640 Propanoate metabolism
    Deima_1999
   00660 C5-Branched dibasic acid metabolism
    Deima_1999
Enzymes [BR:dmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Deima_1999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2172241..2173386
Genome map
AA seq 381 aa AA seqDB search
MKLHEYQGKELLRRFGVNVQEGKVAHTPEEVRAIAEEYGQPVVVKAQVHVGGRGKAGGVK
FSPTADKAVENAQKILGMDIKGLTVNKVLVTKAVDIDAGVEYYVGMIVDRNVQSFTLMAC
AEGGMEIEELAAERPEAIIRHRVDPVAGLRPFEAREIALKAGFKGNLNKIADMMVKMSKA
ALELDATLVEINPLFVDADGTPLALDTKFDMDDNAVYRHKDIAAWRELEAEHPLEVEASE
YGFAYVKLDGNVGVLGNGAGIVMTSLDVVNRAGAKPANFLDIGGGARADIVYNAVKLVSK
DSDVKSIFVNIFGGITRADEVAKGIIQALQEGILTKPVRMRVAGTAEEEAKALLADVNSP
LIQMYPDMFQAAEAAAQEANK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactccacgagtaccaaggcaaagaactgctccgccgtttcggcgtgaacgttcag
gaaggcaaggtcgcgcacacccccgaggaagtgcgcgccattgctgaggaatacggccag
ccggtcgtcgtcaaggcgcaggtgcacgtcggtggccgcggcaaggccggcggcgtcaaa
ttcagccccaccgccgacaaggccgtcgagaacgcccagaagatccttggcatggacatc
aagggcctcacggtcaacaaggtcctcgtcaccaaggccgtcgacatcgacgccggcgtc
gagtactacgtcggcatgatcgtggaccgcaacgtccagtccttcacgctgatggcctgc
gccgaaggcggtatggaaatcgaggagctcgccgccgagcgccccgaagcgatcatccgt
caccgcgtggaccccgtcgcgggcctgcgccccttcgaagcgcgcgaaatcgccctcaag
gccggcttcaaaggcaacctgaacaagatcgccgacatgatggtcaagatgagcaaggcc
gcgctcgaactcgacgcgaccctcgtggagatcaacccgctgttcgtggacgccgacggc
acccccctcgcactcgacacgaagttcgacatggacgacaacgccgtgtaccgccacaag
gacatcgccgcgtggcgcgaactcgaagcggaacacccgctcgaagtggaagccagcgag
tacggcttcgcgtacgtgaagctcgacgggaacgtcggcgtgctcggcaacggcgccggc
atcgtgatgaccagcctcgacgtcgtgaaccgcgccggcgccaagcccgcgaacttcctc
gacatcggcggcggcgcccgcgccgacatcgtctacaacgccgtgaagctcgtcagcaag
gacagcgacgtgaagagcatcttcgtgaacatcttcggcggcatcacccgcgccgacgaa
gtcgcgaagggcatcatccaggcgctccaggaaggcatcctcaccaagcccgtgcgcatg
cgcgtggccggcactgccgaagaggaagccaaggcgctgctcgcggacgtgaacagcccc
ctgatccagatgtacccggatatgttccaggccgcggaggccgccgcccaggaggccaac
aaatga

DBGET integrated database retrieval system