KEGG   Deinococcus maricopensis: Deima_2039Help
Entry
Deima_2039        CDS       T01412                                 

Definition
(GenBank) Butyrate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00010  Glycolysis / Gluconeogenesis
dmr00620  Pyruvate metabolism
dmr00640  Propanoate metabolism
dmr00680  Methane metabolism
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01130  Biosynthesis of antibiotics
dmr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deima_2039
   00620 Pyruvate metabolism
    Deima_2039
   00640 Propanoate metabolism
    Deima_2039
  Energy metabolism
   00680 Methane metabolism
    Deima_2039
Enzymes [BR:dmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Deima_2039
Lipid biosynthesis proteins [BR:dmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Deima_2039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADV67682
UniProt: E8U9E3
Position
2207648..2209354
Genome map
AA seq 568 aa AA seqDB search
MTGQVIPVHGEGSAGARMFQAARAVLLAHAHDPVAAHAAFRWPQLDTFNWALDVFAPLAA
RLGDAPALFWEGGAWSYAALDARANQVANFLASLGVRRGDRVLVMLGNTPELWAVLIACM
KLGAPILPAATLLTPEDLRDRVERGGVTTVVTDAGGADRFAGLPGALRRVSVGDVPGWQA
LSGADAQASTFMPDGATRATDPLLLYFTSGTTSRPKLVVHSHASYPVGHLSTAFYIGLRE
GDRHWNISSPGWAKHAWSSFFVPLTTGAGIYLDDARFDARATLEKLVRHGITTMCAPPTV
WRMLIQQDLAAYPVALREAVGAGEPLNPEVIERVQAAWGVTIRDGYGQTETTAQVGNPPG
APVKAGSMGRPLPGYDVVLLDAAGQEADEGELNLRLGAQRPLGLMVGYDGDPERTREVLG
GVAYPTGDVARRDEDGYLFYVGRADDVFKSSDYRLSPFELESFLVTHAYVAEAAVVPSPH
AERLSVPKAYVVLAAGVEPCADVARELLAYAREGLAPYKRVRRLEFMELPKTISGKIRRV
ELRAHAARSVEGGARGALEFWEEDFPVA
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacaagtcatccctgttcacggtgagggcagcgcaggcgcccggatgttccag
gcggcgcgcgcggtgctgctggcgcacgcccacgacccggtcgcggcgcacgccgcgttc
cgctggccgcaactggacacgttcaactgggcgctggacgtgttcgcgcccctggctgcg
cggctgggggacgcgcccgcgctgttctgggagggcggggcgtggtcgtacgcggcgctg
gacgcccgcgcgaatcaggtggcgaacttcctggcgagcctgggcgtgcggcgcggggac
cgcgtgctggtgatgctgggcaacacgccggagctgtgggcggtgctgatcgcgtgcatg
aagctgggcgcgccgatcctgccggcggcgacgctgctcacgccggaggacctgcgggac
cgcgtggagcgcgggggcgtcacgacggtcgtcacggatgcgggcggcgcggacaggttc
gcgggcctgccgggggcgctgcggcgcgtgagcgttggtgacgtcccgggctggcaagcg
ctgagcggcgcggacgcgcaggcgagcaccttcatgccggacggggccacgcgcgccacg
gacccgctgctgctgtacttcacgtccggcacgaccagccggccgaaactggtggtgcac
tcgcacgcgtcgtacccggtcgggcacctcagcaccgccttctacatcgggctgcgcgaa
ggggaccgtcactggaacatcagttcgcccgggtgggcgaagcacgcgtggagcagcttc
ttcgtgccgctcacgaccggcgcgggcatctacctggatgacgcgcgcttcgacgcgcgc
gcgacgctggaaaaactggtgcggcacggcatcacgaccatgtgcgcgccgcccaccgtg
tggcgcatgctgatccagcaggacctcgcggcgtaccccgtggcgctgcgcgaggcggtg
ggcgcgggcgagccgctcaacccggaggtgattgagcgcgtgcaggcggcgtggggcgtc
acgatccgcgatggctacggtcagacggagacgacggcgcaggtcggcaacccgccgggc
gcgcccgtgaaggccggcagcatgggccgtccactccccgggtacgacgtggtgctgctg
gacgccgccgggcaggaagcggacgagggcgaactcaacctgcgcctgggcgcgcagcgt
ccgctcgggctgatggtcgggtacgacggcgacccggagcgcacgcgggaagtgctgggg
ggcgtggcgtaccccacgggcgacgtcgcccgccgggacgaggacggctacctgttctac
gtgggccgcgcggacgacgtgttcaagagcagcgattaccgcctctccccgttcgagctg
gagtcgttcctggtgacgcatgcgtacgtggcggaagcggcggtcgtgccgagcccgcac
gcggagcgcctgagcgtcccgaaggcgtacgtggtgctcgcggcgggcgtggagccgtgc
gcggacgttgcgcgcgagctgctggcgtacgcccgcgagggcctcgcgccgtacaagcgg
gtgcgccgcctcgagttcatggaactgccgaaaaccatcagtgggaagatccgccgggtg
gagttgcgggcgcacgcggcgcggagcgtggagggtggcgcgcgcggggccctggaattc
tgggaggaggatttcccggtggcgtaa

DBGET integrated database retrieval system