KEGG   Deinococcus maricopensis: Deima_2321Help
Entry
Deima_2321        CDS       T01412                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dmr  Deinococcus maricopensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deima_2321
Enzymes [BR:dmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Deima_2321
Exosome [BR:dmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deima_2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2505795..2507648
Genome map
AA seq 617 aa AA seqDB search
MPDTLPLTDDTLRDFANGALVRPDQLLGAHPDTQGGVTGMRFAVWAPNAQRVSVIGDFNG
WNHDEHPLHRHGWGVWSTFVPHAHHGQLYKYIVTTPDGRAVHKTDPYAHSMELRPGLAAR
VWAPEPYAWGDEHWMRTRDAGVTRPISVYEVHLGSWARGWSNEFLNYRELAHRIGDHVTH
LGYTHVELMGVLEHPFDGSWGYQVTGYYAPTARHGTPEDFKYFVNHLHERGVGVLLDWVP
GHFPTDEGGLAAYDGTPTYEYADPRKGYHPDWNTLIFDYGRHEVAAFLIGSALSWLQDYH
IDGLRVDAVASMLHLDFSRRAGEWLPNGYGGNHNLEAIWFLKRFNDAVHHLAPGTITIAE
ESTSFPGVTSPTPDGLGFDYKWAMGWMNDTLAYFEQDPIYRQYAHHKLTFFNVYRTSERY
MLPISHDEVVHLKKSLVEKMPGDWWQRRAGLRAFLALQWATPGKKLLFMGQEFAQTSEWN
HDASLPWHLTAYADHADVMTLVRNLNFLYRGHPALHCGDHHEGGMRWINADDAHRNAYAF
ARRDPGGQHEVIVVANLSAVPMYGYGVRVDGGAYRAILNSDDPWYGGGAMPIGDLPVHDG
HLFIDVPPHAVIYLERA
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacacgcttcccctcacggacgacaccctgcgcgacttcgccaacggcgcgctc
gtgcgccccgaccagctgctcggcgcgcatcccgacacccagggcggcgtgaccgggatg
cgcttcgccgtctgggcccccaacgcccagagggtgagcgtcatcggcgacttcaacggc
tggaaccacgacgaacaccccctgcaccgccacggctggggcgtctggagcactttcgtg
ccgcacgcgcaccacgggcagctctacaaatacatcgtcacgacgcccgacggccgcgcc
gtccacaagaccgacccgtacgcgcacagcatggaactccgccccggcctcgccgcgcgc
gtctgggcgccggagccgtacgcctggggtgacgagcactggatgcgcacccgcgacgct
ggcgtcacccgtcccatcagcgtctacgaggtgcacctcggctcctgggcgcgcggctgg
tcgaacgaattcctgaactaccgcgaactcgcgcaccgcatcggcgaccacgtcacccac
ctcgggtacacgcacgtggaactcatgggcgtcctggagcaccccttcgacggctcctgg
ggctaccaggtgaccggctactacgcccccaccgcgcggcacggcacccccgaggacttc
aagtacttcgtgaaccacctgcacgaacgcggcgtcggcgtgctcctcgactgggtgccc
gggcacttcccgaccgacgagggcggcctcgccgcgtacgacggcacccccacctacgag
tacgccgacccccgcaagggctaccaccccgactggaacaccctgattttcgactacggc
cgccacgaggtcgccgcgttcctgatcggctccgccctctcctggctgcaggactaccac
atcgacggcctgcgcgtggacgccgtcgccagcatgctgcacctcgacttctcccgccgc
gccggcgagtggctccccaacgggtacggcgggaaccacaacctcgaagcgatctggttc
ctgaaacgcttcaacgacgccgtccaccacctcgcgcccggcaccatcaccatcgccgag
gagagcacgtcgttcccgggcgtcacgtcacccacgcccgacggcctcggcttcgactac
aagtgggcgatgggctggatgaacgacaccctcgcgtacttcgagcaggaccccatctac
cgccagtacgcgcaccacaagctcacattcttcaacgtgtaccgcaccagcgaacgctac
atgctgcccatcagccacgacgaagtcgtccacctgaaaaaaagcctggtggagaagatg
cccggcgactggtggcagcgccgcgccggcctgcgggccttcctcgcgctgcaatgggcc
acgcccggcaagaagctcctgttcatggggcaggaattcgcgcagacgagcgaatggaac
catgacgcgtccctcccctggcacctcacggcgtacgccgaccacgcggacgtcatgacg
ctcgtgcggaacctgaatttcctgtaccgggggcacccggccctgcactgcggtgaccac
cacgagggcggtatgcgctggatcaacgcggacgacgcgcaccgcaacgcgtacgcgttc
gcgcgccgcgacccgggcggccagcacgaggtcatcgtcgtcgcgaacctcagtgccgtc
cccatgtacggttatggcgtccgcgtggacggcggggcgtaccgcgcgatcctgaacagc
gacgacccctggtacggcggtggcgccatgcccatcggcgacctccccgttcacgacggg
cacctgttcattgacgtgcccccgcacgccgtgatctacctcgaacgcgcctga

DBGET integrated database retrieval system