KEGG   Deinococcus maricopensis: Deima_2366Help
Entry
Deima_2366        CDS       T01412                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dmr  Deinococcus maricopensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dmr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dmr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2553775..2554878)
Genome map
AA seq 367 aa AA seqDB search
MSARRVVLKLGTSVLTAGTDRLHRPRLVDLTRQIAALHAEGTQVVLVSSGAVLAGWEALG
FPPRTRTLAEKQLLAAVGQGRLMHTYATLADLYGLNVAQVLLTADDFRARARYLNARTTL
HGCLERGILPVINENDTVAVEQIKVGDNDTLSAFVANLVEADLLLILTDAPGLYTADPRS
HPEATLIPEVPRVDAGIWALAGGAGTHRGTGGMHTKIQAAEIATRAGTPVVIASGDERDA
LLRVAHGEPIGTRFHAHGAPLEARKRWILAEVASASRITLDAGAATAVRERGSSLLPVGV
VDVQGDFERGQTVRVYGPDGHEIARGLTRYRADDLRRVQGRHSGDIAAVLGYEYGPELIH
RDDLILL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctcgccgcgtcgtcctgaaactcggaaccagcgtcctcaccgccggcacggac
cgcctgcaccgcccccgcctcgtggacctcacgcgccagattgccgcgctccacgctgaa
ggcacccaggtcgtcctggtcagcagcggcgccgtcctggccggctgggaagcgctcggg
ttccccccgcgcacccgcaccctcgccgaaaagcagctgctcgccgccgtcggccagggc
cgcctgatgcacacctacgccaccctcgcggacctgtacggcctgaacgtcgcgcaggtg
ctcctcaccgccgacgacttccgcgcccgcgcccgctacctcaacgcccgcaccaccctg
cacggctgcctggaacgcggcatcctgcccgtcatcaacgagaacgacaccgtcgccgtc
gagcagatcaaggtcggcgacaacgacaccctcagcgccttcgtcgcgaacctcgtcgag
gcggacctgctgctgatcctcacggacgcgcccggcctgtacaccgccgacccgcgcagc
caccccgaagcgaccctgattcccgaggtgccccgcgtggacgcgggcatctgggcgctc
gccggcggcgccggcactcaccgcgggaccggtggcatgcacaccaaaattcaggcggcg
gaaatcgccacgcgcgccggcacgcccgtcgtcatcgccagcggcgacgaacgcgacgcc
ctgctgcgcgtcgcgcacggcgagccgatcggcactcgcttccacgcgcacggcgcgccc
ctggaggcccgcaaacgctggattctcgcggaggttgcgtccgccagccgcatcaccctc
gacgcgggcgccgccactgcggtgcgcgagcggggcagcagcctcctccccgtgggcgtc
gtggacgtgcagggcgacttcgaacgcggccagacggtgcgcgtgtacggcccggacggc
cacgaaatcgcgcgtggcctcacgcgctaccgcgccgacgacctgcgccgcgtgcagggc
cgccactccggcgacattgccgccgtgctcgggtacgagtacggcccggagctgattcac
cgtgacgacctgattctgctctaa

DBGET integrated database retrieval system