KEGG   Deinococcus maricopensis: Deima_2547Help
Entry
Deima_2547        CDS       T01412                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dmr  Deinococcus maricopensis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dmr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:dmr00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2731911..2732690
Genome map
AA seq 259 aa AA seqDB search
MTTDRQISDQRVALVTGGTSGIGLAIAQRLRDDGLRVAVLDLDREEARAVANDAAFLFVG
ADLSRRADCRAAVDAVTGAFGRLDVLVNNAGFQHIDPIVDFPEDTWDAMLHVMLTAPFLL
SKYAWAHLAASGQGRIVNVASIHAQVASPFKSAYISAKHGLIGLTRTQALEGADAGLTAN
AICPAYVRTPLVTRQIADQARTRGISEADVEQQVMLEPAAIKRLLDPVDVAALASYVVSP
AAWGMTGAVLDLDLGWTAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaccggcagatttcggatcagcgcgtcgccctcgtgacgggcggcaccagc
ggcatcggcctcgccatcgcccagcgcctgcgggacgacgggctgcgcgtcgctgtgctc
gacctggaccgcgaggaggcgcgggccgtcgcgaacgacgcggcattcctgttcgtcggc
gcggacctctcgcggcgcgccgactgccgcgccgccgttgacgccgtcacgggcgcgttc
gggcggctggacgtgctcgtgaacaacgcgggcttccagcacatcgaccccatcgtggac
ttcccggaggacacctgggacgccatgctgcacgtcatgctgaccgcgccgttcctgctc
agcaagtacgcgtgggcgcacctcgcggcgagcgggcagggccgcatcgtgaacgtcgcg
agcattcacgcgcaggtggcgagcccgttcaagagcgcgtacatcagcgcgaagcacggg
ctgatcggcctgacgcgtacgcaggcgctggagggcgcggacgcgggcctcaccgcgaac
gcgatctgcccggcgtacgtgcgcacgccgctggtgacgcggcagatcgcggatcaggcg
cgtacgcgcggcatcagcgaggcggacgtggagcagcaggtgatgctggagcccgcggcg
atcaagcgcctgctggacccggtggacgtcgcggcgctcgcgtcgtacgtggtgagcccg
gcggcgtggggcatgacgggcgcggtgctggacctcgacctgggctggaccgcccggtag

DBGET integrated database retrieval system