KEGG   Deinococcus maricopensis: Deima_2548Help
Entry
Deima_2548        CDS       T01412                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dmr  Deinococcus maricopensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dmr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dmr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2732796..2733887
Genome map
AA seq 363 aa AA seqDB search
MTDAALSPSAPSLTRTPWGTAPDGSAITLYTLRHGPVTARIMDYGGVIVGVDAPDRDGTL
ADVALGHDEAGPYFDRATASYFGALIGRYGNRIARGRFELDGRAHQLATNNGPNALHGGP
GGFDQVMWTSDADVTADGPRVTLTRTSPDGEEGYPGALDVTVTYTLTADGALRLAYHAVT
DAPTVVNLTNHSYWNLAGATRDVLDHELVVHADAITPVDETLIPTGTLLDVAGTPFDFRA
ARRVGERVDDADAQLQFAGGYDHNFVLQGAAGALRHVATLSDPQSGRVMEVHTTEPGVQF
YSGNFLDGSVTGKGGQVYGHRWAVCLETQHFPDSPNRPDFPSTRLNPGEVYRTVTEYRFR
TQS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgctgccctctccccttccgccccgtcccttacgcgcacgccgtgggggacc
gcgccggacggctcggccatcaccctctacaccctgcgccacggtcccgtcacggcccgg
atcatggattacggcggcgtgatcgtcggcgtggacgccccggaccgcgacggcacgctc
gcggacgtggcgctcgggcacgacgaggccgggccgtacttcgaccgggcgaccgcgtcg
tacttcggcgcgctgatcgggcggtacgggaaccgcattgcccgcgggcggttcgaactg
gacggccgggcgcaccagctcgccacgaacaacggcccgaacgcgctgcacggcggaccc
ggcgggttcgatcaggtgatgtggaccagcgacgcggacgtcacggcggacggcccgcgc
gtgacgctgacgcgcaccagcccggacggtgaggaaggctacccgggcgcgctggacgtg
accgttacgtacacgctcacggcggacggcgcgctgcgcctggcgtaccacgcggtcacg
gacgcgccgacggtcgtgaacctcaccaaccactcgtactggaacctcgcgggggccacg
cgggacgtgctcgaccatgaactggtcgtgcacgcggacgcaatcacgcccgtggacgag
acgctgatccccaccgggacactgctggacgtggcgggcacgccgttcgacttccgcgcg
gcgcggcgcgtgggcgagcgcgtggacgacgcggacgcgcagctgcagttcgcgggcggg
tacgaccacaatttcgtactgcagggggcggcgggcgcgctgcgccacgtggcgacgctc
agcgacccgcagtcgggccgcgtgatggaggtgcacacgaccgagccgggcgtgcagttc
tactccgggaacttcctggacggcagcgtgaccggcaagggcgggcaggtgtacgggcac
cgctgggcggtgtgcctggagacgcagcacttcccggacagcccgaaccgcccggacttc
ccgagcacgcgcctgaacccgggtgaggtgtaccggacggtcacggagtaccgcttccgc
acgcagtcctga

DBGET integrated database retrieval system