KEGG   Deinococcus maricopensis: Deima_2578Help
Entry
Deima_2578        CDS       T01412                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
dmr  Deinococcus maricopensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2764583..2765608)
Genome map
AA seq 341 aa AA seqDB search
MDLLQAAAPSGFETRAADVWARHAEQFGARTHRDHFGNAYAATGPEDAAPIVLLGHLDEI
GLMVSHVGDEGLLAVRALGGWDPQVLVGQRVRLLADGGDLFGVVGKKAIHLMEAEERTKA
STIKDLWVDTGLPVDEVRARIPVGTVAVIEQPPLQLGDKLASKALDNRLGAFIVLEAVRV
LHERGTKHHVVAVGTAQEEIGAHGALVATYALRARAGIAVDVTHESTQPGADEKELGRVP
FGSGANLAVSAMTNPGILRDLQAAARDENIPFSLSASPRASWTDADTAILTRAGVPMGVV
SIPLRYMHSPSEMVDVRDVQACIDIIVAWVERSGDRTDYTR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacctcctgcaggccgccgcgcccagcggcttcgaaacgcgcgccgccgacgtctgg
gcgcgtcacgccgagcagttcggcgcgcgcacccaccgtgaccacttcgggaacgcgtac
gcggccactggccccgaagacgcggcgcccatcgtgctgctcggccacctcgacgagatc
ggcctgatggtctcccacgtgggcgacgagggtctgctcgccgtgcgcgccctgggcggc
tgggacccgcaggtgctggtcgggcagcgcgtgcgtctgctcgcggacggcggcgacctc
ttcggcgtggtcggcaaaaaggccattcacctgatggaagccgaggagcgcacgaaagcc
agcaccatcaaggacctctgggtggacacgggcctgccggtcgacgaggtgcgcgcgcgc
atcccggtcgggacggtcgccgtcatcgagcagccgcccctgcagctcggtgacaagctg
gccagcaaggcgctcgacaatcgtctcggcgcgttcatcgtgctggaggccgtgcgcgtc
ttgcacgagcgcggcacgaagcatcacgtggttgcggtcgggacggcacaggaggagatc
ggcgcgcacggcgcgctcgtcgcgacgtacgcgttgcgcgcccgcgccggcattgccgtg
gacgtaacgcacgaatccacccagcccggcgcggacgagaaggaactgggccgcgtgccg
ttcgggagcggcgcgaacctcgcggtgagcgccatgacgaaccccggcatcctgcgggac
ctccaggcggccgcgcgcgacgagaacattccgttcagcctgagcgccagcccgcgcgcg
tcgtggacggacgcggacacggcgatcctgacgcgggcgggcgtgccgatgggcgtcgtg
agcatcccgctgcgctacatgcattccccgagtgagatggtggacgtccgcgacgtgcag
gcgtgcatcgacatcatcgtggcgtgggtggagcgcagcggcgaccgcaccgactacacg
cgctga

DBGET integrated database retrieval system