KEGG   Deinococcus maricopensis: Deima_2782Help
Entry
Deima_2782        CDS       T01412                                 

Definition
alpha,alpha-trehalose-phosphate synthase (EC:2.4.1.15)
Orthology
K00697  
trehalose 6-phosphate synthase [EC:2.4.1.15]
Organism
dmr  Deinococcus maricopensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dmr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2965580..2966968)
Genome map
AA seq 462 aa AA seqDB search
MGLIVLSNREPYAPTRNDNGELQWTPSIGGLTAALDPALQHAGGTWIAWGEQHPDVTDVD
LPTEQPRYRLKRIRLSDAEVRDYYYGFSNRALWPISHYFIERTQYHASAWRAYVNVNRRF
ADAAIAAYQDGDLIWVHDYQLALVPRMIRDALPNARIGFFWHIPWPSVEVFRTLPWDLDI
LDGILGADLIGMHTPDYVAHFQNTCRRALRADTSGDLVHWKGRAARIVDRPIGIEVDAYE
HLATSPEVEDTADRIRRTLQTQILLGVDRLDYTKGIPERLEAFDLFLDRHPETRGRVTLL
QIAVPSRERVDSYRQLRNQVEGLVGRINGKHTQGGWSPIQYIYRGVPRDELVAHYRAADA
MLVTPLRDGLNLVAKEFAACARDGALILSRFAGAADEMPEAIQVNPYSPENLSDAMRTAL
QMPLDEKKARLTRLREHLRDSDLHAWTDTFLHELKLQDHGGA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgatcgtcctctccaaccgcgaaccctacgcccccacccgcaacgacaacggc
gaactccaatggacgccgtccatcggcggcctcaccgccgccctcgacccggccctgcag
cacgccggcggcacctggatcgcctggggcgaacaacaccccgacgtcaccgacgtcgac
ctccccaccgaacagccccgttaccgcctcaaacgcatccgcctcagcgacgccgaagtc
cgcgactactactacggcttctccaaccgcgccctctggcccatcagtcactacttcatc
gaacgcacccagtaccacgcgagcgcctggcgcgcctacgtgaacgtcaaccgccgcttc
gccgacgccgccatcgccgcctaccaggacggcgacctcatctgggtgcatgactaccag
ctcgccctcgtgccccgcatgatccgcgacgccctcccgaacgcccgcatcggcttcttc
tggcacatcccctggcccagcgtcgaagtgttccgcacgctcccctgggacctcgacatc
ctcgacggcatcctcggcgccgacctcatcggcatgcacacccccgactacgtcgcgcac
ttccagaacacctgccgccgcgccctgcgcgccgacacctccggcgacctcgtccactgg
aagggccgcgccgcccgcatcgtcgaccgccccatcggcatcgaagtcgacgcctacgaa
cacctcgccaccagccccgaagtcgaagacaccgccgaccgcatccgccgcaccctccag
acgcagatcctcctcggcgtcgaccgcctcgactacaccaaaggcatccccgaacgcctc
gaagcgttcgacctgttcctcgaccgccaccccgaaacgcgcggccgcgtcacgctcctc
cagatcgccgtgcccagccgcgaacgcgtcgactcctaccgccagctccgcaaccaggtc
gaaggcctcgtgggccgcatcaacggcaaacacacccagggcggctggtcccccatccag
tacatctaccgcggcgtcccccgcgacgaactcgtcgcccactaccgcgccgccgacgcc
atgctcgtcacccccctccgcgacggcctgaacctcgtcgccaaagaattcgccgcgtgc
gcccgcgacggcgccctcatcctctcccgcttcgccggcgccgccgacgaaatgcccgaa
gccatccaggtaaacccctacagccccgagaacctctccgacgccatgcgcaccgccctc
cagatgcccctcgacgagaaaaaagcccgcctcacgcgcctgcgcgagcacctgcgggac
agcgacctgcacgcctggacggacaccttcctgcacgaactcaagcttcaagaccacgga
ggcgcatga

DBGET integrated database retrieval system