KEGG   Deinococcus maricopensis: Deima_2790Help
Entry
Deima_2790        CDS       T01412                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dmr  Deinococcus maricopensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:dmr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dmr00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dmr00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2973749..2975029
Genome map
AA seq 426 aa AA seqDB search
MPVDIKVPVFAESVSEGTLLTWHKKPGDAVKRDEVIAEIETDKVVLEVTVPQDGVLVSAL
KNEGDTVLSEEVLGVIGEAGAAQATPAASVDADRTGGPVASAESGSAVATAASNDALSPA
VRKIVAEHNLDAGSIPATGPKGNITKADAAAVAAQGGLTYQGPQAAAQPASMPSAPTHTA
PATPAPAVSVPQGERPEQRVPMTRIRQRIAERLKDVQNTAAILTTFNEVNMKPAMDLRKK
YQDQFVAKHGTKLGFMSLFVRAATEALKQFPVVNASVEGKDIIYHGYYDLGIAVASDRGL
VVPVLRDTDHMSLADIEKAIAGFAQKAKAGKLTMDDMSGGTFSITNGGTFGSMMSTPIIN
QPQSAILGMHNIIERPIAQNGQVVIAPMMYIALSYDHRIIDGKEAVQFLVTIKNLLEDPA
RMLLDI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtagacatcaaagtgcccgtgttcgccgaatccgtcagcgaagggaccctgctc
acttggcacaagaagcccggcgacgccgtgaagcgcgatgaggtcatcgcggaaatcgag
acggacaaggtcgtcctcgaagtgaccgtcccgcaggacggcgtgctcgtcagcgccctg
aagaacgaaggcgacaccgttctcagcgaggaagtgctcggcgtgatcggcgaggcgggt
gccgcccaggcgacgccggccgcgagtgtggacgcggaccgcacgggcggcccggtcgcc
agtgccgagagcggcagcgcggtcgcgacggccgcgtcgaacgacgcgctgtccccggcc
gtgcgcaagatcgtcgccgagcacaacctcgacgccggcagcatccccgcgaccggcccg
aaaggcaacatcacgaaggctgacgcggccgcggtcgccgcgcagggcggcctgacgtac
cagggcccgcaggcggcggcgcagcccgccagcatgcccagcgcgcccacgcacaccgcc
ccggcgacgcccgccccggctgtcagcgtcccgcaaggcgagcgcccggagcagcgcgtc
cccatgacgcgcatccgccagcgcatcgcggaacgcctgaaggacgtgcagaacaccgcc
gcgatcctcacgacgttcaacgaagtgaacatgaaacccgcgatggacctgcgcaagaag
taccaggaccagtttgtcgcgaagcacggcacgaaactcggcttcatgagcctgttcgtg
cgcgccgccaccgaggcgctcaagcagttcccggtcgtcaacgccagcgttgaaggcaag
gacatcatctaccacgggtactacgatctcggcatcgctgtcgcgtccgaccgtggcctg
gtggtgccggtcctgcgcgacacggaccacatgagcctcgcggacatcgagaaggccatc
gcgggcttcgcgcagaaggccaaggccggcaagctcaccatggacgacatgagcggcggc
acgttcagcatcaccaacggcggcaccttcggctccatgatgagcacgcccatcatcaac
cagccgcagagcgccattctcgggatgcacaacatcatcgagcggcccatcgcgcagaac
ggccaggtcgtcatcgcgccgatgatgtacatcgcgctcagctacgaccaccgcatcatc
gacgggaaggaagccgtgcagttcctggtgaccatcaagaacctgctggaagaccccgcc
cgcatgctgctcgacatctga

DBGET integrated database retrieval system