KEGG   Deinococcus maricopensis: Deima_2790Help
Entry
Deima_2790        CDS       T01412                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00020  Citrate cycle (TCA cycle)
dmr00310  Lysine degradation
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01130  Biosynthesis of antibiotics
dmr01200  Carbon metabolism
Module
dmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deima_2790
  Amino acid metabolism
   00310 Lysine degradation
    Deima_2790
Enzymes [BR:dmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Deima_2790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADV68419
UniProt: E8UBI0
Position
2973749..2975029
Genome map
AA seq 426 aa AA seqDB search
MPVDIKVPVFAESVSEGTLLTWHKKPGDAVKRDEVIAEIETDKVVLEVTVPQDGVLVSAL
KNEGDTVLSEEVLGVIGEAGAAQATPAASVDADRTGGPVASAESGSAVATAASNDALSPA
VRKIVAEHNLDAGSIPATGPKGNITKADAAAVAAQGGLTYQGPQAAAQPASMPSAPTHTA
PATPAPAVSVPQGERPEQRVPMTRIRQRIAERLKDVQNTAAILTTFNEVNMKPAMDLRKK
YQDQFVAKHGTKLGFMSLFVRAATEALKQFPVVNASVEGKDIIYHGYYDLGIAVASDRGL
VVPVLRDTDHMSLADIEKAIAGFAQKAKAGKLTMDDMSGGTFSITNGGTFGSMMSTPIIN
QPQSAILGMHNIIERPIAQNGQVVIAPMMYIALSYDHRIIDGKEAVQFLVTIKNLLEDPA
RMLLDI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtagacatcaaagtgcccgtgttcgccgaatccgtcagcgaagggaccctgctc
acttggcacaagaagcccggcgacgccgtgaagcgcgatgaggtcatcgcggaaatcgag
acggacaaggtcgtcctcgaagtgaccgtcccgcaggacggcgtgctcgtcagcgccctg
aagaacgaaggcgacaccgttctcagcgaggaagtgctcggcgtgatcggcgaggcgggt
gccgcccaggcgacgccggccgcgagtgtggacgcggaccgcacgggcggcccggtcgcc
agtgccgagagcggcagcgcggtcgcgacggccgcgtcgaacgacgcgctgtccccggcc
gtgcgcaagatcgtcgccgagcacaacctcgacgccggcagcatccccgcgaccggcccg
aaaggcaacatcacgaaggctgacgcggccgcggtcgccgcgcagggcggcctgacgtac
cagggcccgcaggcggcggcgcagcccgccagcatgcccagcgcgcccacgcacaccgcc
ccggcgacgcccgccccggctgtcagcgtcccgcaaggcgagcgcccggagcagcgcgtc
cccatgacgcgcatccgccagcgcatcgcggaacgcctgaaggacgtgcagaacaccgcc
gcgatcctcacgacgttcaacgaagtgaacatgaaacccgcgatggacctgcgcaagaag
taccaggaccagtttgtcgcgaagcacggcacgaaactcggcttcatgagcctgttcgtg
cgcgccgccaccgaggcgctcaagcagttcccggtcgtcaacgccagcgttgaaggcaag
gacatcatctaccacgggtactacgatctcggcatcgctgtcgcgtccgaccgtggcctg
gtggtgccggtcctgcgcgacacggaccacatgagcctcgcggacatcgagaaggccatc
gcgggcttcgcgcagaaggccaaggccggcaagctcaccatggacgacatgagcggcggc
acgttcagcatcaccaacggcggcaccttcggctccatgatgagcacgcccatcatcaac
cagccgcagagcgccattctcgggatgcacaacatcatcgagcggcccatcgcgcagaac
ggccaggtcgtcatcgcgccgatgatgtacatcgcgctcagctacgaccaccgcatcatc
gacgggaaggaagccgtgcagttcctggtgaccatcaagaacctgctggaagaccccgcc
cgcatgctgctcgacatctga

DBGET integrated database retrieval system