KEGG   Deinococcus maricopensis: Deima_2807Help
Entry
Deima_2807        CDS       T01412                                 

Definition
(GenBank) Polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00010  Glycolysis / Gluconeogenesis
dmr00520  Amino sugar and nucleotide sugar metabolism
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01130  Biosynthesis of antibiotics
dmr01200  Carbon metabolism
Module
dmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deima_2807
   00520 Amino sugar and nucleotide sugar metabolism
    Deima_2807
Enzymes [BR:dmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Deima_2807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADV68436
UniProt: E8UBJ7
Position
complement(2989266..2990018)
Genome map
AA seq 250 aa AA seqDB search
MTDPQQILGIDIGGSGIKGAPVDVTTGQLLAERHRIPTPEGADPDDVARVITEIQRHFGW
DGPVGCTFPGVVRRGTTLTAANVSKDWVGLDAAKLLADATGTPVQVLNDADAAGLAEARF
GAGKDVTGVVILLTFGTGIGSAVIQHGTLLPNTEFGHMEFNGHEAEAWASDRARERDELG
WKAWAKRAGAFMGYLEMLFSPDLFIVGGGVSKKADKWQDHLDLRTPVQPATLKNAAGIVG
AALHAHEHTR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccctcagcagatcctgggtatcgacatcggcgggagcggcatcaagggcgcg
cccgtggacgtcaccaccgggcagctcctcgcggagcgccaccgcatccccacccccgaa
ggtgccgaccccgacgacgtcgcgcgcgtcatcaccgaaattcagcggcacttcgggtgg
gacggcccggtcggctgcaccttcccgggcgtcgttcgccgcggcacgaccctcaccgcc
gcgaacgtcagcaaggactgggtgggtctcgacgccgcgaaactcctcgcggacgcgacc
ggcacgcccgtgcaggtcctgaacgacgcggacgccgccggcctcgccgaagcgcgcttc
ggcgccggcaaggacgtgaccggcgtggtgatcctgctgaccttcggcaccggcatcggc
agcgccgtcatccagcacggcaccctgctgcccaacacggaattcgggcacatggagttc
aatgggcacgaggccgaagcgtgggcgtcggaccgcgcgcgcgaacgagacgaactcggc
tggaaggcctgggcgaaacgcgccggggcgttcatgggctatctggagatgctgtttagc
cctgacctgttcatcgtgggcggcggggtcagcaagaaggccgacaagtggcaggaccac
ctggacctgcgcacgcccgtccagcccgccacgctcaagaatgcggcgggcatcgtcggc
gcagccctgcacgcgcacgagcacacccgctga

DBGET integrated database retrieval system