KEGG   Deinococcus maricopensis: Deima_2825Help
Entry
Deima_2825        CDS       T01412                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dmr  Deinococcus maricopensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dmr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dmr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3006293..3007753
Genome map
AA seq 486 aa AA seqDB search
MKLHDLAAELNLTPPAENPDVTGVTHHAGWVRPGFAFVAVRGARVDGHAFMAEAAANGAV
CVFGEGLPDGVPSPLPYVRVPGARAALADAAAALAGHPSRALRVVGITGTDGKTTTSWIT
RHLLRAAGVRTGLLSTVGYELPDGALRHFPAHFTTPEAPEVQSTLSEIGASGGEAVVLEA
SSHALALDRVRAVDWDVAVWTHLTSEHLDFHGTVEQYFADKARLVERARFSVLNADDPWT
AQLRPRAAAYVTYGVEDVADWRAGDIEERSTGLHFHVLSPLGEFDAHLPMVGRFNVHNAL
AAMAAAAHLGSGVDALVAGLASFRGVPGRMELVPGGDAGVRVVVDFAHTPPSLEKALEAL
RSTTRGRLIVLLGSAGGPRDPGKRAPLGEVATRLADTAIFTEEDHRDTPLDDILQEMARG
AREAGRGNFELVPDRRDAIRRAVALARPGDTVLLAGKGPEDTLERGAETLPWDEVAEARA
ALAVRA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcatgacctcgctgccgagctgaacctcacgcctcccgctgagaatccggat
gtgacgggggtgacgcatcacgccgggtgggtgaggccggggttcgcgttcgtggccgtg
cggggcgcgcgcgtggacgggcacgcgttcatggcggaggccgcggcgaacggcgcggtg
tgcgtgttcggtgagggcctgccggacggcgtgccgagcccgctgccgtacgtgcgcgtg
ccgggcgcgcgggcggcgctggcggacgcggcagcggccctggcggggcacccgagccgc
gcgctgcgcgtggtgggcattacgggcacggacgggaagacgacgaccagctggatcacg
cggcacctgctgcgcgcggcgggcgtgcggacagggttgctgagcaccgtggggtacgag
ctgccggacggggcgctgcggcacttcccggcgcatttcacgacgccggaggcgccggag
gtgcagtcgaccctttcggagatcggtgcgagcggcggcgaggcggtggtgctggaggcg
agcagccacgcgcttgcgctggaccgcgtgcgcgccgtggactgggacgtggcggtctgg
acgcacctgacgagcgagcacctggatttccacgggacggtggagcagtacttcgcggac
aaggcgcggctggtggagcgcgcgcgcttctcggtgctgaacgcggatgacccgtggacg
gcgcagctccggccgcgcgcggcggcgtacgtgacgtacggtgtggaggacgtcgcggac
tggcgggcgggcgacattgaggagcgcagcacgggcctgcatttccacgtgctgtcgccg
ctcggggagttcgacgcgcacctgccgatggtggggcggttcaacgtgcacaacgcgctc
gcggcgatggcggcggcggcgcacctggggtcgggcgtggacgcgctcgtggcggggctg
gcgtcgttccggggcgtgccggggcgcatggagctggtgccgggcggggacgcgggcgtg
cgcgtggtggtggatttcgcgcatacgccgccgagcctggaaaaggcgttggaggcgttg
cggtccacgacgcgggggcgcctgatcgtgctgctcgggtcggcgggcgggccgcgcgat
ccggggaagcgcgcgccgctgggggaggtcgccacgcgcctggcggatacggcgatcttt
acggaggaggatcaccgggacacgccgctggacgacatcctgcaggagatggcgcggggc
gcgcgcgaggcggggcgggggaatttcgagctggtgccggaccggcgcgacgcgattcgc
cgggcggtggcgttggcgcggcctggggatacggtgctgctggccgggaagggcccggag
gacacgctggagcggggcgcggagacgctgccgtgggatgaggtggcggaggcgcgcgcg
gcgctggcggtgcgcgcatga

DBGET integrated database retrieval system