KEGG   Deinococcus maricopensis: Deima_3057Help
Entry
Deima_3057        CDS       T01412                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dmr  Deinococcus maricopensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deima_3057
Enzymes [BR:dmr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Deima_3057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3235377..3236819
Genome map
AA seq 480 aa AA seqDB search
MQANTVGELLQLPAYQGRAPFDGRTRLVQDEVRDNLIRKLRAKENLFPGVVGYDETVVPQ
LVNALLARQNFILLGLRGQAKSRILRAITNLLDETVPAINASDINDDPLNPISAHGQELL
REYGDRLEIRWIPREERYVEKLATPDVTVADLIGDVDPIKAARLGTALGDVRAMHFGLLP
RANRGIFAVNELADLAPKVQVALFNILQEGDVQIKGYPVRLELDVMLVFSANPEDYTARG
KIVTPLKDRIGSEIRTHYPRTVDLGMDITAQEAYRDPSVVVPTFIAELIEEIAFQAREDN
RVDKLSGVSQRLPISLMELASANAEVRALTGGDDPVVRVADIYAGLPAITGKMELEYEGE
LKGAENVAREVIRKAAGQVYARRFSSADTRDLEKWFADGNVFRFPQAGDARAAMSAARDV
PGLADLAVDVAGDARDAVRVAAAEFILEGLYGRKKLSRAEESYAAPEPEMKQPGRGGRWN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccaacaccgtcggtgaactgctgcaacttcccgcctaccagggccgcgcgccg
ttcgacggccgcacgcgcctcgtgcaagacgaagtccgtgacaacctcatccgtaaactc
cgcgcgaaggagaacctcttcccgggcgtcgtcggctacgacgagaccgtcgtgccgcaa
ctcgtgaacgccctgctggcccggcagaacttcatcctgctcggcctgcgcggccaggcg
aaaagccgcatcctgcgcgccatcacgaacctgctcgacgagaccgtgcccgccatcaac
gcgagcgacatcaacgacgaccccctcaaccccatcagcgcgcacgggcaggagctcctg
cgcgagtacggcgaccgcctggaaatccgctggattccccgcgaggaacgctacgtcgag
aagctcgccacgcccgacgtgaccgtcgcggacctgatcggcgacgtggaccccatcaag
gccgcgcgcctcggcaccgccctcggcgacgtgcgcgccatgcacttcgggctgctgccg
cgcgcgaaccgcggcatcttcgccgtgaacgaactcgcggacctcgcgccgaaagtgcag
gtggcgctgttcaacatcctccaggaaggcgacgtgcagattaagggttaccccgtgcgc
ctcgaactggacgtgatgctggtgttcagcgcgaaccccgaggactacaccgcgcgcggc
aagatcgtcacgcccctcaaggaccgcatcggcagcgaaatccgcacgcactacccccgc
accgtggacctcggcatggacatcaccgcgcaggaagcgtaccgcgaccccagcgtcgtc
gtgccgaccttcatcgcggaactcatcgaggagatcgcgttccaggcgcgcgaggacaac
cgcgtggacaagctcagcggcgtgtcgcagcgcctccccatcagcctgatggaactcgcc
agcgcgaacgccgaggtgcgcgccctcacgggcggcgacgacccggtcgtgcgcgtcgcg
gacatctacgcgggcctgcccgccatcaccggcaagatggaactcgagtacgagggcgaa
ctcaaaggcgcagagaacgtcgcccgcgaggtgatccgcaaggccgccgggcaggtgtac
gcgcgccggttctcgtccgcggacacgcgcgacctggagaagtggttcgcggacggcaac
gtgttccgcttcccgcaggccggggatgcgcgcgccgccatgagcgccgcgcgggacgtg
ccgggcctcgcagacctcgcagtggacgtggccggtgacgcgcgggacgccgtgcgcgtc
gccgctgccgagttcatcctggaaggcctgtacggccgcaagaagctttcccgcgcggag
gagagctacgccgcgccggaacccgagatgaaacagccaggccgcggcggacgctggaac
tga

DBGET integrated database retrieval system