KEGG   Deinococcus maricopensis: Deima_3077Help
Entry
Deima_3077        CDS       T01412                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00010  Glycolysis / Gluconeogenesis
dmr00052  Galactose metabolism
dmr00500  Starch and sucrose metabolism
dmr00520  Amino sugar and nucleotide sugar metabolism
dmr00521  Streptomycin biosynthesis
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01130  Biosynthesis of antibiotics
dmr01200  Carbon metabolism
Module
dmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deima_3077
   00052 Galactose metabolism
    Deima_3077
   00500 Starch and sucrose metabolism
    Deima_3077
   00520 Amino sugar and nucleotide sugar metabolism
    Deima_3077
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Deima_3077
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Deima_3077
Enzymes [BR:dmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Deima_3077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADV68706
UniProt: E8UC45
Position
complement(3256014..3256916)
Genome map
AA seq 300 aa AA seqDB search
MLSLVPTLTPVSSALALDIGGSHVTAAVVDASARAVLPSSRIHAPVPQDAPADVILEAWA
DAARHAAGAARVDAIGLAVPAPFEYATGVSRLQHKFAALYGLNVLGGLRACLAGTPLAAL
PVVFGNDADLFALGEWWAGAARGEARVIGVTLGTGLGAGFIDAGAVITDRVDVPPGGELW
NTPYLDGIAEAYACGAAVTRAYAAQTGETASAAEVARRAPHDPAARAAFETLGRHLGAIL
RPHVAAFGASCVVVGGNVARAWPLFSHALQGALPGVACRPSVRFDEAALLGAAVLTQRAP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgctcgtgcccacgctcacgcctgtttcctcggcccttgcgctcgacattggc
ggcagtcatgtgaccgcggcggtcgtggacgcgtccgcgcgcgccgtcctgccgtcctcc
cgtatccatgcgcccgtcccgcaggacgcgcccgccgacgtgattctggaggcgtgggcg
gacgcggcgcgccacgcggcgggcgcggcgcgcgtggacgccatcgggctggcggtgccc
gcgccgttcgagtacgccaccggcgtgtcgcgcctgcagcacaagttcgcggcgctgtac
ggcctgaacgtgctcggtggcctgcgggcgtgcttggcggggacgccgctcgcggccctg
ccggtggtgttcgggaacgacgcggacctgttcgccctcggggagtggtgggcgggcgcg
gcgcgtggtgaagcccgcgtaatcggcgtgacgctcggcacgggcctgggggccgggttc
atcgacgcgggcgcggtgatcacggaccgcgtggacgtgccgccgggcggggagctgtgg
aacacgccgtacctggacggtatcgccgaggcgtacgcgtgcggcgcggccgtcacccgc
gcgtacgccgcgcagacgggggagacggccagcgccgccgaagtcgcgcgccgcgccccc
cacgacccggctgcccgcgcggcgttcgagacgctcgggcggcacctgggcgccatcctg
cgtccgcacgtggcggcgttcggcgcgtcgtgtgtggtggtgggcggcaatgtggcgcgc
gcgtggccgctgttcagccacgcgctccagggagcgcttccgggggtggcctgccgcccg
agcgtacggttcgacgaggcggcgctgctgggcgcggccgtcctcacccagcgcgcgccg
taa

DBGET integrated database retrieval system