KEGG   Deinococcus maricopensis: Deima_3097Help
Entry
Deima_3097        CDS       T01412                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dmr  Deinococcus maricopensis
Pathway
dmr00071  Fatty acid degradation
dmr00280  Valine, leucine and isoleucine degradation
dmr00281  Geraniol degradation
dmr00310  Lysine degradation
dmr00360  Phenylalanine metabolism
dmr00362  Benzoate degradation
dmr00380  Tryptophan metabolism
dmr00410  beta-Alanine metabolism
dmr00627  Aminobenzoate degradation
dmr00640  Propanoate metabolism
dmr00650  Butanoate metabolism
dmr00903  Limonene and pinene degradation
dmr00930  Caprolactam degradation
dmr01100  Metabolic pathways
dmr01110  Biosynthesis of secondary metabolites
dmr01120  Microbial metabolism in diverse environments
dmr01130  Biosynthesis of antibiotics
dmr01212  Fatty acid metabolism
Module
dmr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dmr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Deima_3097
   00650 Butanoate metabolism
    Deima_3097
  Lipid metabolism
   00071 Fatty acid degradation
    Deima_3097
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Deima_3097
   00310 Lysine degradation
    Deima_3097
   00360 Phenylalanine metabolism
    Deima_3097
   00380 Tryptophan metabolism
    Deima_3097
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Deima_3097
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Deima_3097
   00281 Geraniol degradation
    Deima_3097
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Deima_3097
   00627 Aminobenzoate degradation
    Deima_3097
   00930 Caprolactam degradation
    Deima_3097
Enzymes [BR:dmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Deima_3097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADV68726
UniProt: E8UC65
Position
complement(3275639..3276400)
Genome map
AA seq 253 aa AA seqDB search
MTSTTVHVARSGPVATLTLASKRGAFGPAFWRDLPAALADLGDARALIIRGQAGTFSVGL
DLHQTAPIIAAALPQDGEFLRLVDEMQQALNALAALPIPVIAAVDGWCIGAGLELISACD
VRLATTSARFSLPEVTLGIVADLGGLSRLPPLIGLGRTQHLALTGDPIDAPTALNWGLVT
ELHDTEDALLTRAETLAARLAALPPRAAEGTKRTLNAHLPHADSLRHAAQWNADHLDLNA
LGAHLQKLSRSNG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccaccaccgtgcacgtggcccgcagcggccccgtcgccacgctcaccctcgcc
agcaaacgcggcgcgttcggccccgccttctggcgcgacctgcctgccgccctcgcggac
ctcggggacgcccgcgccctgatcatccgcgggcaggcaggcaccttcagcgtcggcctc
gacctccaccagaccgcgcccatcatcgcggccgccctcccacaggacggcgaattcctg
cgcctcgtggacgagatgcagcaggccctgaacgccctcgcggccctgcccatccccgtc
atcgccgccgtggacggctggtgcatcggcgcgggcctggagctcatcagcgcctgcgac
gtgcgcctcgccacaaccagcgcgcgcttcagcctccccgaagtcacgctcggcatcgtc
gccgacctgggcggcctctcccgcctcccgccgctcatcggcctcggacgcacccagcac
ctcgccctcaccggcgaccccatcgacgcccccaccgcgctcaactggggcctcgtcacc
gaactgcacgacaccgaagacgccctgctgacccgcgccgaaacgctcgccgcgcgcctc
gccgccctgcccccccgcgccgccgaaggcaccaaacgcaccctgaacgcgcacctcccg
cacgcggacagcctgcgccacgccgcgcagtggaacgccgaccacctcgacctgaacgcc
ctcggcgcgcacctccagaagctcagccgctccaacggctga

DBGET integrated database retrieval system