KEGG   Deinococcus maricopensis: Deima_3290Help
Entry
Deima_3290        CDS       T01412                                 

Definition
phenylalanyl-tRNA synthetase subunit alpha
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
dmr  Deinococcus maricopensis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:dmr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3484321..3485400
Genome map
AA seq 359 aa AA seqDB search
MQQEALQAIQDAPTLDALQAVKTKYVGKSGLITRELGTLGKLPPEERKARGAEINAVRAA
VEAALTEREATLKRAALDAKLASEAIDVTLPGTPLPSGGLHLITRILDDLTDIFTRLGYA
VVEGQEVEDDTHNFDALNIPWYHPARDLWDTFWLEDGRLLRTHTSPMQVRYMLEHTPALK
IVVPGKVYRYEATDATHESMFHQLEGLVVGDHISMADLKGTIAEMARGLFGARAKVRFQP
SYYPFVEPGADFAVWWENPRGESKWLELGGCGMVHPNVFKAVDDLREQMGRQRIYEGKTG
FAFGLGPERIAMLKYGIPDIRYFYANDLQILGQFRGDLENRAPVPPPSTPNADAAQEAL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagaagccctgcaggccatccaggacgcccccaccctcgacgccctgcaagcc
gtgaagaccaagtacgtcgggaagagcggcctgatcacccgcgagctcggcacgctcggc
aagctcccacccgaggaacgcaaggcgcgcggcgcggaaatcaacgccgtgcgcgccgcc
gtcgaagcggccctcaccgagcgcgaggcgaccctgaagcgcgccgcgctcgacgcgaaa
ctcgcctccgaagccatcgacgtgacgctgcccggcacgcccctcccgtcaggcggcctg
cacctcatcacccgcattctcgacgacctcaccgacatcttcacgcgcctcgggtacgcc
gtcgtggaagggcaggaggtcgaggacgacacgcacaacttcgacgcgctcaacatcccc
tggtaccaccccgcgcgcgacctgtgggacaccttctggctggaagacgggcgcctgctg
cgcacgcacaccagccctatgcaggtgcgctacatgctggagcacacgcccgccctgaaa
atcgtcgtgcccggcaaggtgtaccgctacgaagccaccgacgccacgcacgaaagcatg
ttccaccagctcgaagggctcgtggtgggcgaccacatcagcatggcggacctgaagggc
accatcgcggaaatggcgcgcgggctgttcggcgcgcgcgcgaaggtgcgcttccagccc
agctactacccgttcgtggagcccggcgcggacttcgcggtgtggtgggagaacccgcgc
ggcgaaagcaagtggctggagctcggcgggtgcggcatggtccacccgaacgtcttcaag
gccgtggatgacctgcgcgaacagatgggcaggcagcgcatctacgagggcaagaccggc
ttcgcgttcggcctcggcccggaacgcatcgcgatgctgaagtacggcattccggacatc
cggtacttctacgcgaacgacctgcagatcctcgggcagttccgcggcgacctcgagaac
cgcgcgcccgtaccgccccccagcacccccaacgcggacgccgcgcaggaggccctgtga

DBGET integrated database retrieval system