KEGG   Desulfurococcus mucosus: Desmu_0114Help
Entry
Desmu_0114        CDS       T01406                                 

Definition
tungsten-dependent formaldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dmu  Desulfurococcus mucosus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desmu_0114
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desmu_0114
Enzymes [BR:dmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Desmu_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(108174..110000)
Genome map
AA seq 608 aa AA seqDB search
MYGWWGKVLLVDLTRMKTREIILDPETYRSYIGGRGLAVRLLWDLVPPGADPLSPYNALV
VASGPLSGLPLPSSGKLVVASKSPLTNGYGDGNIGTMASHHLKHSGFDAIVVTGASRKPV
YIYVENEKVEVRSAEHLWGLDTFTTEDKLVREHGRNIGILEIGPAGEHMVKYATVISQKG
RSGGRPGIGAVMGSKRLKAIVVKGTREPPIADKNSLRSISEEAYRKLLESEGYDYWIRQG
TMATIQWSQQNSVLPTMNYREGVWELYETISGDLMEKLKTDRRGCPYCNMQCGNVIADDA
GEESELDYENVAMLGSNILLEDLRRVGEVNKMADKLGLDTISLGNAIGFYMEASERGLVR
ERLEWGDFKAVREIVVDTAYRRGLGAFIAEGVMRMSTSLGGEALDFAMHVKGLEVSAYNC
HTTPGMALAYATSSIGAHHKDAWIISYEVKTDRTSYSREKVERLIFLQNIRGGMFESLTT
CRLPWVELGLNIEYYPKMLSAVTGLEWSINDMHTVADRIYTLIRAFWIREHSGWSRSMDY
PPARWFKHPLTKGPYAGHHLDPLRYEKMLEAYYEMRGWNENGIPRRETLLKLGLDFTIPI
LEKIVELG
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtatggatggtggggtaaggtactcttagtcgatttaacgaggatgaagacgcgtgaa
ataatccttgaccccgagacatataggtcgtacatagggggcaggggcctcgctgtgaga
ctcctatgggatctcgttccaccgggagcagacccgctttcaccatataatgcactagta
gttgcatcaggcccgctctcaggcctacccttgccgagcagtggtaaactagtagtcgcc
tctaaaagcccgttgacaaacggctacggcgacggtaacataggcaccatggcgagccac
catctgaagcacagtggtttcgacgcgatcgtggtgacaggggcgtcccgtaaacccgtc
tacatatatgttgagaacgaaaaggtcgaggtgaggagtgctgaacacctctgggggctt
gacaccttcacaacggaggataaactggtaagggagcatggaagaaacataggtatattg
gagatagggcccgccggggaacacatggtgaaatacgccacggtgatttcccagaagggg
aggagcggcgggcgccccggtatcggtgcagtaatggggagtaagaggttgaaggcgatc
gtggtaaaggggacgagggaaccacccatagccgacaagaactctcttcgaagcatctcg
gaggaggcatataggaagctgcttgaaagcgagggatacgactactggattagacagggc
accatggcgacaatacagtggagtcagcagaacagcgtcttaccaaccatgaactatagg
gaaggagtctgggaactctatgaaaccataagcggagacctaatggagaagctgaagacc
gatagaaggggttgcccatactgcaacatgcagtgtggaaacgttatagcagatgatgca
ggcgaggaaagcgagctagactacgagaacgttgcgatgctgggcagcaacatattgcta
gaggaccttaggagggtaggggaggtaaacaagatggctgacaaactcggcttggacact
ataagcctggggaacgcgataggattctacatggaggcgagtgagagaggactggtcagg
gagagactggagtggggtgacttcaaggctgtccgagaaatagtagtggatacagcatac
aggcgtggactaggcgcattcatagctgagggagtaatgaggatgtcgaccagcctcggt
ggcgaggcattggatttcgctatgcatgttaaggggctcgaggtgtcagcttacaactgt
catacaacccctggaatggctctggcatacgcaacttcatcaataggtgcacaccataag
gatgcatggatcataagctacgaggttaaaacagacaggacatcctatagcagagagaaa
gtggaacgcctcatcttcctgcagaatatacgtggcggaatgttcgagtccctgaccaca
tgcaggctaccctgggttgaactaggcctcaacatcgagtactacccgaagatgctgtca
gcggtaaccgggctggaatggagcatcaacgacatgcacaccgtagcagatagaatatac
acgttgataagagcgttctggatacgcgagcactcagggtggagtcgctccatggactac
ccgcccgcaagatggttcaagcacccgctcaccaagggaccctacgcaggccaccacctg
gatccattaagatatgagaaaatgcttgaagcatactatgaaatgagaggctggaacgag
aacggcatacctagaagggaaaccctcctgaagctcgggctagacttcacgataccaata
ctcgagaaaatagttgaactaggctga

DBGET integrated database retrieval system