KEGG   Desulfurococcus mucosus: Desmu_0132Help
Entry
Desmu_0132        CDS       T01406                                 

Definition
acetyl-CoA synthetase (ADP-forming) subunit beta
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dmu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dmu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dmu00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126762..127460
Genome map
AA seq 232 aa AA seqDB search
MTPRDIIINALKEGRYKLLEHEAFQLIKHYGIPSPEVVVVKSPEEAVALADKVGYPIALK
IVSPDISHKSDVGGVKLGLRSREEVGKAVKEMLETVPRRAPSARIVGVLMYNMAPQGLEV
IIGGVRDSVFGPVVMFGLGGIFVEVLKDVSFRVSPVSKEDALTMLKEIKSASILEGYRGQ
PPVDKDAIAEMIVKTARLMEDNPEIESIDLNPVMAYSKGAIAVDARIILKHS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
ttgaccccccgtgacataataatcaatgcgctcaaggaggggcgatacaagctactggag
cacgaggccttccagctcatcaagcactacgggataccctcaccagaggtagtagtggtt
aagagcccggaggaagcagtagccttagccgacaaagtcggataccccatcgcattaaag
atagtgtcacccgatatatcgcacaagagcgatgtaggtggcgtgaagctagggctcagg
agcagggaggaggttgggaaagccgtaaaggaaatgcttgagacagtgccacgcagagcc
ccgagtgcaaggatagttggagtgctcatgtataacatggcaccccagggcctcgaagta
atcattggaggcgtaagggacagcgtgttcgggccagtggtcatgttcggcctaggagga
atcttcgtagaagtattgaaagacgtatccttcagggtatcccctgtgagcaaggaggat
gcactcacaatgcttaaggagataaagtcagcaagcatacttgaaggctatcgtggccaa
cctccagtagacaaggatgcgatcgccgagatgatcgtgaagactgcgagactaatggag
gataaccctgagatagagtccatagatctaaaccccgtcatggcgtacagtaagggagct
atagctgttgacgccaggatcatacttaaacatagctag

DBGET integrated database retrieval system