KEGG   Desulfurococcus mucosus: Desmu_0291Help
Entry
Desmu_0291        CDS       T01406                                 

Definition
AMP phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
dmu  Desulfurococcus mucosus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Desmu_0291
Enzymes [BR:dmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Desmu_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(275556..277085)
Genome map
AA seq 509 aa AA seqDB search
MGLEGRPKLFEVRVVDIDLHRNLIIMNTSDARELGVVANNVVLVTLGDKSAYATVVTSET
ITQPGVVALSKQTASALGVSEGDKVGVKPVGLPASFNALKKRLHGGRLSEGEMKSIIRDV
VDGVYGEAEIAAFLVSQLYSELGEEELSYLIKAMVETGSRVTFEETVYDVHSIGGVPGNS
KVALLTVPIVAASGLLIPKTSSRAITSPAGTADTMEVLARVDLTMDEIVEIARRVKGVLA
WGGKLNLAPADDIFVNIERRLSIDPDQQMVASILSKKIAMGVERLVIDMPVGRGAKVKDA
STADKLAGLFIRQAGLLGLSIKVALTYGGQPIGTTAGPALEAREALEALIERKGSRSLID
KAVLLAGLVLELSGRAQPGQGEDIAREVFLSGKAYEKFKQIVEAQGGNPNVKPDDIQVGS
HTFTLSSPLEGAVTHIDNAAVSLIARACGAPYDKGAGVRLHAKVGYRVNKGDPLITLYSS
SASRLETAVRLLRDLNPVVVEGMLLKTLP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggtttagaggggaggcctaagctcttcgaggtcagagtagtcgacatagatttacac
aggaatttaatcatcatgaacacgtctgacgccagggaactcggagtggtagcgaacaac
gtggtgctagtgacacttggagacaaatcggcctacgccacagtggtgacaagtgagacc
ataacgcaacccggtgtagtagccctctccaagcagacggcgtcagcgctcggcgtctcc
gagggggataaagtcggggttaaaccagtcgggctgccggcaagcttcaacgcgttgaag
aagaggcttcatggaggaaggctctcggagggggagatgaagagcattataagggatgtc
gttgacggcgtctacggtgaagccgagatagctgccttcctggtcagccagctctacagc
gagctcggcgaggaggagttgagctaccttataaaagccatggttgagacaggcagtagg
gtcacgtttgaggaaacagtgtacgatgtacacagtataggaggcgtgccaggcaacagt
aaggttgcattgctaacagtgcccattgtagcggcctcaggcctcctgataccgaagacc
agtagcagggctataacgagcccggctgggacagctgacacaatggaggtcttggccagg
gtcgacctcactatggatgagatagttgagatagctaggagggttaagggtgttctagcg
tggggaggtaagttgaacctggcgccagccgacgacatcttcgttaacattgagagaagg
ctctcaatagacccggatcaacaaatggtggccagtatactctcaaagaaaatagcgatg
ggggttgaaaggctcgtaatagatatgccggtgggccgcggggccaaggtcaaggatgca
tcgacagccgacaagctggccgggctcttcataaggcaggccggattactcggcctgtca
atcaaggtggctttaacatatggtgggcaaccgataggaaccactgcgggcccggctctc
gaggcaagggaggctctcgaggcactcatcgagagaaaggggagtagaagcctaatagat
aaagcagtgttgctggcagggcttgtactggagctcagtgggagggctcaaccaggccag
ggcgaggacatagctagggaggtcttcctctccgggaaggcgtacgagaagttcaagcag
atagtggaggctcagggcggtaaccccaatgtgaaaccggacgacatacaggtgggctcc
cacaccttcactctctcatcgcctctggagggtgctgtaacacacatagataacgcggcc
gtgtcactgatagctagagcctgtggagccccctacgataagggagccggggtaaggctg
catgcaaaggtaggctacagggtgaacaagggcgacccattgataacgctctacagtagt
agcgcgtcgaggctggagacggctgttagactactgagagacctgaaccccgtggttgtc
gaaggaatgctgctcaagactctaccatag

DBGET integrated database retrieval system