KEGG   Desulfurococcus mucosus: Desmu_0315Help
Entry
Desmu_0315        CDS       T01406                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dmu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dmu00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:dmu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(303188..304474)
Genome map
AA seq 428 aa AA seqDB search
MELRSPQTRDIVPSYWYNITPDLPEQLPPMLHPDGSPVDKRELEALFPRSLVEQEFTTQR
HVEIPGEVVETLLMLGRPTPLIRARRLEEALKTNAVILFKYEGVMPTGSHKVNTAVAQAY
YNAAEGVERVSTETGAGQWGSALSLAGSLFGLKVRVFMVRASYLQKPYRRILMESYGAEV
YPSPSDRTNTGRRLLAENPDHPGSLGIAISEAIEDVVSSGGKAKYSLGSVLNHVLLHQTV
IGLEALKQLEMLGVDRVDYIVGCVGGGSNFAGLSYPFIGHRYNDGDPPVFIAVEPETVPS
MTRGEYRYDYGDTAGLTPLLKMHTLGHDYIPPPIYAGGLRYHGVAPSLSILVKNGLVKPV
AYGESEVLEAGLLFARTQGILPAPESSHAVKAVIDIALKHRGSSRRPVILFNLSGHGLLD
LSAYSRTS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggagttaaggagccctcaaaccagggatatagtcccctcctactggtacaacataacc
ccggatctacctgagcaactcccgccaatgctccatcctgatggaagcccagtggataag
agggagcttgaagcactgttcccaaggagcctcgtggagcaggagttcaccacgcagaga
cacgtggagataccgggcgaggtagttgaaacactactgatgctcggcaggccaaccccg
cttatacgggcccgtagactcgaagaagcgttgaagactaatgccgtaatattattcaag
tacgagggcgtgatgccaaccgggtcgcacaaggttaacacggctgtcgcccaagcatac
tataatgccgctgaaggcgttgaaagagtctccactgagacgggtgctggtcaatggggc
tcagccctctcactagccggcagcctcttcgggttgaaggtaagagtgttcatggtgcgc
gccagctaccttcagaagccctacaggaggatactcatggagtcctatggtgccgaagta
tatccaagccccagtgacaggactaacactggtaggagactgctcgcagagaaccctgat
cacccgggtagcctcgggatagctataagtgaagccatagaggacgtggtctccagcggc
gggaaggcaaagtatagtctcggcagcgtcttaaaccatgttctactgcatcaaaccgtg
atagggttggaggcgttgaagcagctggagatgctcggcgtcgatagagtagactacatt
gtcggctgtgttggcggcggctcgaacttcgccgggttatcctaccccttcataggccac
aggtataacgacggcgacccaccagtattcatagctgttgaacccgaaaccgttccatca
atgaccaggggggaatacaggtatgactacggcgacacagccgggttaacaccactgttg
aagatgcacacccttggacacgactatattccaccaccaatatatgctgggggactcaga
taccatggggttgccccatcgctaagcatacttgtgaaaaacgggttggtgaagccggtt
gcatacggtgagagcgaggtattggaggcaggcctactattcgcgagaacccagggcatt
ctcccagctccagagagctcccacgccgttaaagccgtgatcgacatagcgttaaaacac
aggggttcaagcaggaggccggtgatactcttcaacctaagcggccacggcctactcgac
ctctcagcgtactcccgtacaagctaa

DBGET integrated database retrieval system