KEGG   Desulfurococcus mucosus: Desmu_0315Help
Entry
Desmu_0315        CDS       T01406                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desmu_0315
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desmu_0315
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desmu_0315
Enzymes [BR:dmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desmu_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(303188..304474)
Genome map
AA seq 428 aa AA seqDB search
MELRSPQTRDIVPSYWYNITPDLPEQLPPMLHPDGSPVDKRELEALFPRSLVEQEFTTQR
HVEIPGEVVETLLMLGRPTPLIRARRLEEALKTNAVILFKYEGVMPTGSHKVNTAVAQAY
YNAAEGVERVSTETGAGQWGSALSLAGSLFGLKVRVFMVRASYLQKPYRRILMESYGAEV
YPSPSDRTNTGRRLLAENPDHPGSLGIAISEAIEDVVSSGGKAKYSLGSVLNHVLLHQTV
IGLEALKQLEMLGVDRVDYIVGCVGGGSNFAGLSYPFIGHRYNDGDPPVFIAVEPETVPS
MTRGEYRYDYGDTAGLTPLLKMHTLGHDYIPPPIYAGGLRYHGVAPSLSILVKNGLVKPV
AYGESEVLEAGLLFARTQGILPAPESSHAVKAVIDIALKHRGSSRRPVILFNLSGHGLLD
LSAYSRTS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggagttaaggagccctcaaaccagggatatagtcccctcctactggtacaacataacc
ccggatctacctgagcaactcccgccaatgctccatcctgatggaagcccagtggataag
agggagcttgaagcactgttcccaaggagcctcgtggagcaggagttcaccacgcagaga
cacgtggagataccgggcgaggtagttgaaacactactgatgctcggcaggccaaccccg
cttatacgggcccgtagactcgaagaagcgttgaagactaatgccgtaatattattcaag
tacgagggcgtgatgccaaccgggtcgcacaaggttaacacggctgtcgcccaagcatac
tataatgccgctgaaggcgttgaaagagtctccactgagacgggtgctggtcaatggggc
tcagccctctcactagccggcagcctcttcgggttgaaggtaagagtgttcatggtgcgc
gccagctaccttcagaagccctacaggaggatactcatggagtcctatggtgccgaagta
tatccaagccccagtgacaggactaacactggtaggagactgctcgcagagaaccctgat
cacccgggtagcctcgggatagctataagtgaagccatagaggacgtggtctccagcggc
gggaaggcaaagtatagtctcggcagcgtcttaaaccatgttctactgcatcaaaccgtg
atagggttggaggcgttgaagcagctggagatgctcggcgtcgatagagtagactacatt
gtcggctgtgttggcggcggctcgaacttcgccgggttatcctaccccttcataggccac
aggtataacgacggcgacccaccagtattcatagctgttgaacccgaaaccgttccatca
atgaccaggggggaatacaggtatgactacggcgacacagccgggttaacaccactgttg
aagatgcacacccttggacacgactatattccaccaccaatatatgctgggggactcaga
taccatggggttgccccatcgctaagcatacttgtgaaaaacgggttggtgaagccggtt
gcatacggtgagagcgaggtattggaggcaggcctactattcgcgagaacccagggcatt
ctcccagctccagagagctcccacgccgttaaagccgtgatcgacatagcgttaaaacac
aggggttcaagcaggaggccggtgatactcttcaacctaagcggccacggcctactcgac
ctctcagcgtactcccgtacaagctaa

DBGET integrated database retrieval system