KEGG   Desulfurococcus mucosus: Desmu_0332Help
Entry
Desmu_0332        CDS       T01406                                 

Definition
thiamine pyrophosphate TPP-binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desmu_0332
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmu_0332
   00020 Citrate cycle (TCA cycle)
    Desmu_0332
   00620 Pyruvate metabolism
    Desmu_0332
   00640 Propanoate metabolism
    Desmu_0332
   00650 Butanoate metabolism
    Desmu_0332
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desmu_0332
   00680 Methane metabolism
    Desmu_0332
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desmu_0332
Enzymes [BR:dmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desmu_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
318050..319108
Genome map
AA seq 352 aa AA seqDB search
MTVKTLPEFPVKKGEPAYKLWIFDPGWKGEIPLTFNLRQLAEQKRSVLLPGHRLCAGCAA
PIVVKLASFAFRGPTIVVNATGCLEVASTIFPYTSWAVPWIHVAFENAAAVAGGVESAIK
ALKKTGRLPYDHVDVVVFAGDGGTFDIGFQALSGMAERGHDVLYILYDNEAYMNTGIQRS
GGTPQFAATTTSPAGEVVPGKTQPKKPIADIMVAHRIPYVATGTPAHWMDFMKKVRRGIE
VNGPAFIHALSDCNRGWRHETDISVEIMRRAVDTCYFPLWEWTPEQGYVLTDRSLTIARN
PSLKQPIEKYIEVQGRFRHLLKPENRELLKQFQEYVDKVWEDLLRRASNAPR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttaagactctccccgagttcccggttaagaagggtgagccagcctacaagcta
tggatattcgacccgggctggaagggcgagataccgttaaccttcaaccttagacagctg
gctgagcagaagaggtcggttttgctgccgggccacaggctgtgtgctggttgtgcagcc
ccaatagttgtcaagctagcgagcttcgcgttcaggggtcccacaatagtggtcaatgca
actggctgcctagaagtggcttcaacaatattcccatacactagctgggcggtcccatgg
atccacgttgccttcgaaaacgctgcagcggttgcaggaggcgttgagtcagcgataaaa
gccttgaagaagaccggtagactaccctacgaccacgttgacgtagtggtgttcgccggc
gacggagggacattcgacataggtttccaggccctcagcggtatggctgagagaggccac
gatgtactctacatactgtacgataacgaagcatacatgaacaccggtatacagagatcc
ggtggcacaccccagttcgctgcgacaactacttcaccagccggcgaagtagtgcccggg
aagacccagcccaagaaacccatagcagacataatggtcgcccacaggataccctatgtc
gcaacaggtacaccggcacactggatggacttcatgaagaaggtgaggagaggcatagag
gtcaacgggccagcgttcatacacgccttaagcgactgcaaccgtggatggaggcatgag
acagatatctcagtggagatcatgaggagggctgttgacacatgctacttcccgctatgg
gagtggacgcccgagcagggatacgtgttgactgatagaagcctcactatagctaggaac
ccctccctgaagcagcccatagagaagtacatagaggtgcaggggaggttcaggcatcta
ttgaagcctgagaacagggagctattgaagcagttccaagagtacgttgacaaagtatgg
gaagacctgttgagaagggccagcaatgcccccaggtag

DBGET integrated database retrieval system