KEGG   Desulfurococcus mucosus: Desmu_0335Help
Entry
Desmu_0335        CDS       T01406                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
dmu  Desulfurococcus mucosus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
320362..321462
Genome map
AA seq 366 aa AA seqDB search
MSWRNEYLELVRKLTSLHGTSGREDSVRDLVVDLMKPHVDKLWVDVWGNVVGYRKGSKGA
GRIMLAAHMDEIGLFISHIEDDGFLRVIPVGGVLERTLLYQRVVVKTRDGRLYRGVIGLK
PPHVIKPEEAQKVPEIRELFIDVGASSREEVEKMGIRVGDIAVFDRDVAELSGDRITGKA
FDDRVGVAVMLKALESLGEHQVDVYFVATVQEEVGLKGARTSSYGISPDVALAIDVTIAS
DVPGVAKSEWFTRLGYGPAIKVVDGRNASGLIAHPKVVDFLVSVAEKRKIPYQLDVISGG
TTDASIIALNKEGVAAGTISIPSRYIHSPVEVVDLKDLYNASLLAKAFLEEATPEWVQSV
KGLIVK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgagctggaggaacgaataccttgaactagtgagaaagctaactagtctacatggaacc
agtgggagagaggactcggtgagagacctcgtagtagacctcatgaagccccatgtggat
aagctctgggtcgatgtatggggcaacgtggtcggctacaggaaggggtctaagggcgct
ggtagaataatgcttgcagcccacatggatgaaataggcttattcatctcccacatagag
gacgacggcttcctaagggttatacccgtgggcggggtacttgagaggacgctcctatac
cagagggtagtggttaagactagggatggaagactatacaggggcgtaataggcttgaag
ccgcctcacgtaatcaagcctgaggaagctcagaaggtgcccgagataagggagctattc
atagatgtaggagcatcctccagggaggaggttgagaagatgggtataagggtcggcgac
atagccgtgttcgacagggatgtagcggagctcagcggcgacaggattactggtaaagcc
ttcgatgacagggtgggagtcgccgtgatgctgaaggctttggagtcgcttggagaacac
caggtagacgtatactttgttgcaacagtccaggaggaggtgggtttgaaaggcgccagg
acctcgtcctacggtatctcacccgatgtggctttagcgatagatgtaaccatagcgagc
gatgtaccaggcgtggctaaaagcgagtggtttacacgcctaggctacggcccagcgata
aaagtagtcgacggcaggaacgccagcgggctcatagctcatccaaaggtagtggacttc
ctggtaagcgtcgctgagaagaggaagataccctaccagctggacgtgatctcaggcggt
accactgatgcctcgataatagcgttgaataaggagggggttgcagctggaacaatatcg
ataccttcgagatacatacacagcccggttgaagtagtcgacctcaaagacctctacaat
gcatcgctcctagccaaggccttcctcgaggaggcaacacctgaatgggtgcagagcgtt
aaagggttgatcgtaaagtag

DBGET integrated database retrieval system