KEGG   Desulfurococcus mucosus: Desmu_0335Help
Entry
Desmu_0335        CDS       T01406                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dmu  Desulfurococcus mucosus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desmu_0335
Enzymes [BR:dmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Desmu_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
320362..321462
Genome map
AA seq 366 aa AA seqDB search
MSWRNEYLELVRKLTSLHGTSGREDSVRDLVVDLMKPHVDKLWVDVWGNVVGYRKGSKGA
GRIMLAAHMDEIGLFISHIEDDGFLRVIPVGGVLERTLLYQRVVVKTRDGRLYRGVIGLK
PPHVIKPEEAQKVPEIRELFIDVGASSREEVEKMGIRVGDIAVFDRDVAELSGDRITGKA
FDDRVGVAVMLKALESLGEHQVDVYFVATVQEEVGLKGARTSSYGISPDVALAIDVTIAS
DVPGVAKSEWFTRLGYGPAIKVVDGRNASGLIAHPKVVDFLVSVAEKRKIPYQLDVISGG
TTDASIIALNKEGVAAGTISIPSRYIHSPVEVVDLKDLYNASLLAKAFLEEATPEWVQSV
KGLIVK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgagctggaggaacgaataccttgaactagtgagaaagctaactagtctacatggaacc
agtgggagagaggactcggtgagagacctcgtagtagacctcatgaagccccatgtggat
aagctctgggtcgatgtatggggcaacgtggtcggctacaggaaggggtctaagggcgct
ggtagaataatgcttgcagcccacatggatgaaataggcttattcatctcccacatagag
gacgacggcttcctaagggttatacccgtgggcggggtacttgagaggacgctcctatac
cagagggtagtggttaagactagggatggaagactatacaggggcgtaataggcttgaag
ccgcctcacgtaatcaagcctgaggaagctcagaaggtgcccgagataagggagctattc
atagatgtaggagcatcctccagggaggaggttgagaagatgggtataagggtcggcgac
atagccgtgttcgacagggatgtagcggagctcagcggcgacaggattactggtaaagcc
ttcgatgacagggtgggagtcgccgtgatgctgaaggctttggagtcgcttggagaacac
caggtagacgtatactttgttgcaacagtccaggaggaggtgggtttgaaaggcgccagg
acctcgtcctacggtatctcacccgatgtggctttagcgatagatgtaaccatagcgagc
gatgtaccaggcgtggctaaaagcgagtggtttacacgcctaggctacggcccagcgata
aaagtagtcgacggcaggaacgccagcgggctcatagctcatccaaaggtagtggacttc
ctggtaagcgtcgctgagaagaggaagataccctaccagctggacgtgatctcaggcggt
accactgatgcctcgataatagcgttgaataaggagggggttgcagctggaacaatatcg
ataccttcgagatacatacacagcccggttgaagtagtcgacctcaaagacctctacaat
gcatcgctcctagccaaggccttcctcgaggaggcaacacctgaatgggtgcagagcgtt
aaagggttgatcgtaaagtag

DBGET integrated database retrieval system