KEGG   Desulfurococcus mucosus: Desmu_0356Help
Entry
Desmu_0356        CDS       T01406                                 

Definition
(RefSeq) L-threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desmu_0356
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desmu_0356
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desmu_0356
Enzymes [BR:dmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desmu_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(346505..347773)
Genome map
AA seq 422 aa AA seqDB search
MHVKELRCSRCGRRFLLDEKPLTCPSGDLGRLDIVYDYDAISRSISRDALSSRPFNMWRY
MEFLPVPSSDYVVSLGEGGTPLLKAKRLGERLGLRNLYLKDETRNPTGSFKDRAMSVSVS
MAVYFGFKRAVIASSGNAAASLAAYGARAGIEVYAFVPDFAGYGKIAQLLYYGAKVFKVR
WVESEDPTVKMMRILYEKHGFYPSPSFGVFNPYQVEGPKTISMEVSEQLGWTVPSQVFVP
TGAASLLTGVFNGFRDLNMVGWVDGYPRLVAVQPEGNHPFVRAWMERADPLRIKPWEKPP
ETIATGLEDTYPWDGDAGLRALYKTDGYGVVVSDRDIVEAMRMLAGLEGVFAEPSGAAGL
AGLVKAVENGEVDRDEVVVVLVTGHGLKDPDIVRKTAPEPPLINPDVEEFKKAAREAYGV
SL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgcatgtgaaggagctccgatgcagtaggtgtggtagaagattcctcctcgatgagaag
ccgttgacctgtccaagcggtgacctaggcaggcttgacatcgtgtacgactacgatgcc
atatcgagatccatcagtagagacgcgttgtcaagcaggcccttcaacatgtggaggtac
atggagttcctgcctgtgccaagcagcgactacgtggtgtccctaggggaggggggtacg
cctctcctcaaggctaagaggctcggggagagactcgggttaaggaacctctacctcaag
gatgagacgaggaaccccaccgggagcttcaaggatagggcgatgagcgtctcggtatcg
atggccgtttactttggattcaagcgagctgtgatagcgagcagcggtaatgctgctgca
tcccttgcagcctacggtgccagggcaggcatagaggtgtacgccttcgtcccagacttc
gccggctacggtaagatagcgcagctactctactatggtgcaaaggtattcaaggttaga
tgggttgaatcagaggatccaacggttaaaatgatgaggatcctctacgagaaacacggg
ttctacccgagccccagcttcggcgtcttcaacccctaccaggttgaggggccgaaaacc
atctccatggaggtgagcgagcaactcggctggactgtgccgagccaggtgttcgtgccc
actggtgcggcaagcctgctgacaggggtgttcaacgggttcagggatttaaacatggtt
ggatgggtggacgggtacccgaggctcgtagcagtccaacccgaaggcaaccacccgttt
gtaagagcgtggatggagagggcggatcccttaaggataaagccgtgggagaagccgcct
gaaaccattgcaacaggcctcgaggacacgtacccgtgggacggtgacgctggtctaaga
gccctctataagacagacgggtacggtgtagtcgtgagcgacagggatattgttgaagca
atgaggatgctggcaggcctcgagggggttttcgcggagccgagcggtgcagccgggtta
gccgggctggttaaagccgttgagaacggggaggtagacagggatgaggttgtcgtcgtc
ctcgtcacagggcatgggttaaaggacccggatatcgtgaggaagactgctccggagccc
ccgttgataaaccctgatgtagaggagttcaagaaggctgcgcgggaagcatacggcgtc
tccctctag

DBGET integrated database retrieval system