KEGG   Desulfurococcus mucosus: Desmu_0356Help
Entry
Desmu_0356        CDS       T01406                                 

Definition
L-threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desmu_0356
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desmu_0356
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desmu_0356
Enzymes [BR:dmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desmu_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(346505..347773)
Genome map
AA seq 422 aa AA seqDB search
MHVKELRCSRCGRRFLLDEKPLTCPSGDLGRLDIVYDYDAISRSISRDALSSRPFNMWRY
MEFLPVPSSDYVVSLGEGGTPLLKAKRLGERLGLRNLYLKDETRNPTGSFKDRAMSVSVS
MAVYFGFKRAVIASSGNAAASLAAYGARAGIEVYAFVPDFAGYGKIAQLLYYGAKVFKVR
WVESEDPTVKMMRILYEKHGFYPSPSFGVFNPYQVEGPKTISMEVSEQLGWTVPSQVFVP
TGAASLLTGVFNGFRDLNMVGWVDGYPRLVAVQPEGNHPFVRAWMERADPLRIKPWEKPP
ETIATGLEDTYPWDGDAGLRALYKTDGYGVVVSDRDIVEAMRMLAGLEGVFAEPSGAAGL
AGLVKAVENGEVDRDEVVVVLVTGHGLKDPDIVRKTAPEPPLINPDVEEFKKAAREAYGV
SL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgcatgtgaaggagctccgatgcagtaggtgtggtagaagattcctcctcgatgagaag
ccgttgacctgtccaagcggtgacctaggcaggcttgacatcgtgtacgactacgatgcc
atatcgagatccatcagtagagacgcgttgtcaagcaggcccttcaacatgtggaggtac
atggagttcctgcctgtgccaagcagcgactacgtggtgtccctaggggaggggggtacg
cctctcctcaaggctaagaggctcggggagagactcgggttaaggaacctctacctcaag
gatgagacgaggaaccccaccgggagcttcaaggatagggcgatgagcgtctcggtatcg
atggccgtttactttggattcaagcgagctgtgatagcgagcagcggtaatgctgctgca
tcccttgcagcctacggtgccagggcaggcatagaggtgtacgccttcgtcccagacttc
gccggctacggtaagatagcgcagctactctactatggtgcaaaggtattcaaggttaga
tgggttgaatcagaggatccaacggttaaaatgatgaggatcctctacgagaaacacggg
ttctacccgagccccagcttcggcgtcttcaacccctaccaggttgaggggccgaaaacc
atctccatggaggtgagcgagcaactcggctggactgtgccgagccaggtgttcgtgccc
actggtgcggcaagcctgctgacaggggtgttcaacgggttcagggatttaaacatggtt
ggatgggtggacgggtacccgaggctcgtagcagtccaacccgaaggcaaccacccgttt
gtaagagcgtggatggagagggcggatcccttaaggataaagccgtgggagaagccgcct
gaaaccattgcaacaggcctcgaggacacgtacccgtgggacggtgacgctggtctaaga
gccctctataagacagacgggtacggtgtagtcgtgagcgacagggatattgttgaagca
atgaggatgctggcaggcctcgagggggttttcgcggagccgagcggtgcagccgggtta
gccgggctggttaaagccgttgagaacggggaggtagacagggatgaggttgtcgtcgtc
ctcgtcacagggcatgggttaaaggacccggatatcgtgaggaagactgctccggagccc
ccgttgataaaccctgatgtagaggagttcaagaaggctgcgcgggaagcatacggcgtc
tccctctag

DBGET integrated database retrieval system