KEGG   Desulfurococcus mucosus: Desmu_0506Help
Entry
Desmu_0506        CDS       T01406                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dmu  Desulfurococcus mucosus
Pathway
dmu00300  Lysine biosynthesis
dmu01100  Metabolic pathways
dmu01120  Microbial metabolism in diverse environments
dmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Desmu_0506
Enzymes [BR:dmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Desmu_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ADV64819
UniProt: E8R8J3
Position
complement(504903..506135)
Genome map
AA seq 410 aa AA seqDB search
MDEAGMREVAGRILSGSIEYPTVLGESYEDIVDFYRELLSEHGVHVTVHRVPDELVRKTL
PREFNPEKPRFILLARIGSGDRIIQFNGHYDVVAPGEGWETPPFKPVIRGDLVYGRGATD
MKGGIAAVLTAMISLAEGREPGVVVEAALVPDEEIGGRTGTGYLVSELGSKPDYVVIAEP
SGLDNIYIGHRGNVWGIVKTYGRQAHGSAPWLGDNAFEKMIVFAQVFLKKYRELISLRKS
SYMYEDERAAQPTITPGGALYAPGSINIVPGEAGFSIDRRLIVEEKVEDVAREIKDMVEK
VAAELGVQASFTLVESSPPAFTPPSHEYTVLLSKVVEKTTGVEPRKTICVGGLDLRYYTL
KGIPAVSYGPGEVGLAHKPNEYIRLSDVVKAAAIYAEYVREFEKTGAPRS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagctggaatgcgtgaagtagccgggagaatactttcaggcagcatagaatac
cccactgtcctcggggagtcatacgaggacatagtggacttctacagggagctactctcc
gagcacggtgtccacgtcaccgtgcacagggttcccgacgagcttgtgaggaagactctg
ccaagggaattcaaccctgagaaacccaggttcatattactggctagaataggcagcggc
gacaggattatacagttcaacgggcactacgatgtcgttgcaccaggcgagggctgggag
accccgcccttcaagccggttatcagaggcgacttggtctacgggcgtggagcaacagat
atgaagggtgggatagcggcagtgctcacggcaatgatcagcttagcggagggaagggag
ccaggagtagtggttgaggctgcactagtgccagatgaggagatagggggtaggaccggt
acaggctacctggtctccgagctggggagcaagcctgactacgtggtgatagccgagcca
tccggcctcgacaacatatatatagggcacaggggcaacgtctggggtattgtgaagacc
tatgggaggcaggcccatggctcagccccgtggctgggtgacaatgcattcgagaagatg
atagtgttcgcccaggttttcctcaagaagtacagggagctgatatcgctgaggaagagc
agctacatgtatgaggatgaaagagccgcacagcccacgattacgccgggcggagccctt
tacgcaccgggctcaataaacattgtgcccggggaagccggcttcagcatagacaggagg
ctaatagtcgaggagaaggttgaagacgtggcgagggagataaaggacatggtggagaag
gtggcagccgaactaggggtacaggcatccttcacccttgtcgagtcatcgccccctgcc
ttcacgcctcccagccacgagtacactgtgctcctgagcaaggtggtggaaaagaccact
ggtgtggagcccaggaaaaccatatgtgtcggtggattagacctcaggtactatactttg
aaaggaatacccgctgtatcctacgggccaggcgaggtcgggttagcacataagccgaat
gaatacataaggctcagcgatgtcgtaaaagcggctgcaatatacgctgaatacgtgagg
gagttcgagaagacgggtgcaccgaggagttga

DBGET integrated database retrieval system