KEGG   Desulfurococcus mucosus: Desmu_0595Help
Entry
Desmu_0595        CDS       T01406                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dmu  Desulfurococcus mucosus
Pathway
dmu00010  Glycolysis / Gluconeogenesis
dmu00052  Galactose metabolism
dmu00500  Starch and sucrose metabolism
dmu00520  Amino sugar and nucleotide sugar metabolism
dmu00521  Streptomycin biosynthesis
dmu01100  Metabolic pathways
dmu01110  Biosynthesis of secondary metabolites
dmu01120  Microbial metabolism in diverse environments
dmu01130  Biosynthesis of antibiotics
dmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmu_0595
   00052 Galactose metabolism
    Desmu_0595
   00500 Starch and sucrose metabolism
    Desmu_0595
   00520 Amino sugar and nucleotide sugar metabolism
    Desmu_0595
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desmu_0595
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Desmu_0595
Enzymes [BR:dmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Desmu_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADV64904
UniProt: E8R8S8
Position
complement(590896..591894)
Genome map
AA seq 332 aa AA seqDB search
MGQPRYIAVDIGASKTRIALCDGSRILDKVVFSTPRTGDSRTIAEAIVSKTIEKWREELG
SIEAVGVASIGPLDLERGRVVKTPNLPFEEIELLEPLSRMLGVKVYVVNDAVAGAWGEKH
FGAGRHVRNLLYVTLSTGVGGGVVVDNHLLLGKQGNAHEIGHIVVDYDSDLRCGCGGYGH
WEAYAGGGNLPRVALWLLEKNPGLYRGSVLAERLRSGIQVTSVDVFSLYRAGDPLAADVV
GHYIRATAAGLASAINVYDPELVIIGGGVFLNNADILLKPVKRRVLKEIVTRPPIIQPTS
LGDDVGLYGALAIAVEPPPELLEAQGRSFHQG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgggacaacctagatacatagccgtggatataggggcgtcgaagactaggatagcttta
tgcgacgggagcaggatacttgacaaggtggttttttccacgccgagaaccggtgacagc
aggactatagccgaggcaatagtctccaagaccattgagaaatggagggaggaattaggg
agcatagaggccgtgggggttgcctcgataggtcctctcgacctggagaggggtagagtt
gtcaaaaccccgaacctccccttcgaggaaatagagctcctggagccgttgagcaggatg
ctcggtgtaaaagtatatgttgtcaacgacgctgtggccggtgcatggggggagaagcat
tttggcgctgggagacacgttagaaacctgctatatgtaacactaagcacgggcgtcggc
ggaggagtagtagtcgacaaccacttgctcctaggaaagcaaggcaatgcacatgaaata
gggcacatagttgtagactacgactcagacctcaggtgtgggtgcggcggctacggtcac
tgggaggcctacgctgggggaggcaacttgcctagggtggcactctggctcctcgagaag
aacccaggtctctacaggggaagcgtgcttgctgaaaggcttaggagcgggatccaggtg
accagcgtagacgtgttttcactctatagggccggtgatcccctcgcagcagatgttgta
gggcactatataagggccacggcagcgggactggcatcggccataaacgtgtatgaccca
gagctcgtaatcataggcggcggcgtcttcctgaacaatgctgacatcctgctgaagcct
gtgaagaggagagtgctcaaggagattgtaaccaggccacctatcatacagccaacaagc
ctaggggatgatgtcggcctctacggggctctcgcaatcgcggtggaaccaccccctgag
ctactggaagcgcagggcaggagctttcatcagggttag

DBGET integrated database retrieval system