KEGG   Desulfurococcus mucosus: Desmu_0616Help
Entry
Desmu_0616        CDS       T01406                                 

Definition
glyceraldehyde-3-phosphate ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:dmu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dmu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dmu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(612396..614360)
Genome map
AA seq 654 aa AA seqDB search
MEKRRYRALFIDASSRRHWVEEYDLSEIYSPISLGLKLHMEIYKSWSKPVYHPDNVLVLG
AGLFAGSKMYGTHRFIAVFRSPLTRGLHVSEMGGAAFQFRVNADALVVLGRSEVPLIVKV
YDKGDGEPVVEFHEIPDDTLEGVWRGYKGYRGIYALQQYLSDSFTGFYEEFNGRSILVGP
ASKYTNIGALASITLSKGRMDLGSEDFAARAGGGSVLYRAHGVAAIIYGGRYDRSVKVPV
ELNDVRELDKLFMEITRQPYTQSVINAGVKYRYDPKLNTGGTLGGNYPHLKVTTPVFNWN
MIYLPKAVRERLHELIMKHIWEPFNKEAIESRSWKTCGEPCPLACKKVRLGKYKSDYEPY
NGLGPFIGVMDIHDAEKVVELADAYGFDAIELGQIVGFIFEALYKGLLKPEEVGLPGKPF
FDPAAYTMEHSRVNAELATRIVEQLAFGTNPVLRLIGEKGLRAAAKVLDILYRERVVEKK
TWFSDIPVYAAFGEEGHITPNFYWTPGLIAPLAVLGKYWTVYSGVFMEPEDFASKSVERA
IYEALISDAGLCRFHRGWAEKAVPILLEKFYGVEKPLEKTRELYKRIAEYQKLAGALPVF
WESGKTVDFMALAAEEYGSPEWVAKFKADKKAAAREWWERFYRRVEELVGLGAR
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcgcaggtatagggcattgttcattgatgcttcaagcagaaggcactgggtt
gaggagtatgatttaagcgagatctactcgcctatctcactaggactgaagctccacatg
gagatatacaagtcgtggagtaaaccagtttaccaccctgacaacgtgctcgtactaggg
gcagggttgttcgcagggtcgaagatgtatggtacccataggttcatcgcagtgttcagg
agcccgcttaccagggggctccacgtctccgagatgggtggggctgcattccagttcagg
gtcaacgctgacgcgctagtcgtcttaggcaggtctgaggtgccgttaatagttaaagta
tatgataaaggcgacggagaacccgttgtagagttccacgagataccggatgacacactg
gagggagtatggaggggctacaaggggtacaggggcatctacgcgttacagcagtatcta
agcgatagcttcacagggttctacgaggagttcaacgggagatccatacttgttgggccg
gcctccaagtacacgaatataggtgcactggcatctataaccctgagtaaggggaggatg
gatctcgggagcgaggacttcgcggctagggctggcggtggcagcgtactctacagggcg
cacggtgttgcagccataatatatggaggcagatacgataggagcgttaaagtacccgtg
gagctcaacgatgtaagggagctcgacaagctattcatggagataacgaggcaaccctac
actcaatcagtgatcaatgcaggcgtgaagtacaggtatgacccgaagctgaacaccggt
ggaacactcggcggcaactacccacacctaaaggttacgacgccggtcttcaactggaac
atgatctacctgcctaaagccgttagggagagactccacgagctgataatgaagcacatt
tgggagcccttcaacaaggaggccattgagtcgaggagctggaagacatgcggggagcca
tgtccccttgcatgcaagaaggtgaggctgggcaagtataagagcgactacgagccctac
aacggcctaggccccttcataggcgtcatggatatacatgacgctgagaaagtagtcgag
ctcgccgacgcctacggcttcgacgccatagagctggggcagatagtgggcttcatattc
gaggccctctacaagggattgttgaagccggaggaggttggactaccgggtaaacccttc
ttcgacccagcagcctacaccatggaacactcccgggtgaacgctgagctagctactaga
atagttgaacagctcgccttcggcacgaacccggtgctccgcttaataggtgagaaaggg
ctgagggcggccgccaaggttctcgacatattataccgggagagagtcgtcgagaagaag
acatggttcagcgatataccggtctacgctgccttcggtgaggaaggccatataacaccc
aacttctactggacgccagggctaatagcccccctggctgtcctagggaaatactggact
gtctacagcggcgtcttcatggagccagaggactttgcctccaagtctgttgagagggct
atatatgaggcactgatatccgacgccgggctctgcaggttccacagaggctgggctgag
aaagcagtaccaatactcctcgagaaattctacggtgtcgagaaaccccttgagaagaca
cgtgaactctacaagaggatagcagagtatcagaagctcgcgggtgcactcccagtgttc
tgggagtcgggtaagacagtagacttcatggctctggcagccgaggagtacggtagccct
gaatgggttgccaagttcaaggcagataagaaggcggcggcaagggagtggtgggagcgc
ttctataggagggttgaggagctagtagggcttggagcccgctga

DBGET integrated database retrieval system