KEGG   Desulfurococcus mucosus: Desmu_0624Help
Entry
Desmu_0624        CDS       T01406                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dmu  Desulfurococcus mucosus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dmu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(623713..624339)
Genome map
AA seq 208 aa AA seqDB search
MYTDLKARIVEVARYLEEHGLNHGRSGNISLRIPGVNHVLITPSGLVKSRLSSEDIVVVD
VNGSIVEGHRKPSSEVNLHLAIYRARGDVNAVIHAHTVYATALAVARRPLPPVIEEAILV
IGGEVKVAEFAPYGTLQLAENVVKALEGRKAALLANHGVVAVGESLEEALEVLVSLERLS
QVYLLSEILTGGKTPLLPPEAVSRLLGK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgtacactgacctcaaggctagaatagttgaggtcgcgaggtatcttgaggaacacggg
ttaaaccacggtagatcggggaatataagccttaggataccgggcgtgaaccacgtgctc
ataacccctagtgggctggttaagtcccgtctgagtagcgaggacatagtagtggtcgat
gtaaacggctccatagttgaggggcataggaagccatcatcggaggtaaaccttcaccta
gcaatatatagggctaggggagacgtcaacgctgtgatacatgcacacacagtatacgct
acagcactcgccgtagcgagaagacctctcccccctgtaatcgaagaggcaatactggtg
atcgggggcgaggtcaaggtagcagagttcgcgccctacggcactcttcagctagctgag
aacgtcgtcaaggccctggagggacgtaaggcagccctcttagcgaaccatggtgttgta
gccgttggtgaaagcctcgaggaggccctggaggtgcttgtctcactcgaaaggctttca
caggtatacctgctctcagagatactcaccggggggaaaacccctctactgcctcctgaa
gccgtctccaggctcttggggaagtag

DBGET integrated database retrieval system