KEGG   Desulfurococcus mucosus: Desmu_0624Help
Entry
Desmu_0624        CDS       T01406                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dmu  Desulfurococcus mucosus
Pathway
dmu00051  Fructose and mannose metabolism
dmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Desmu_0624
Enzymes [BR:dmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Desmu_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADV64932
UniProt: E8R8V6
Position
complement(623713..624339)
Genome map
AA seq 208 aa AA seqDB search
MYTDLKARIVEVARYLEEHGLNHGRSGNISLRIPGVNHVLITPSGLVKSRLSSEDIVVVD
VNGSIVEGHRKPSSEVNLHLAIYRARGDVNAVIHAHTVYATALAVARRPLPPVIEEAILV
IGGEVKVAEFAPYGTLQLAENVVKALEGRKAALLANHGVVAVGESLEEALEVLVSLERLS
QVYLLSEILTGGKTPLLPPEAVSRLLGK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgtacactgacctcaaggctagaatagttgaggtcgcgaggtatcttgaggaacacggg
ttaaaccacggtagatcggggaatataagccttaggataccgggcgtgaaccacgtgctc
ataacccctagtgggctggttaagtcccgtctgagtagcgaggacatagtagtggtcgat
gtaaacggctccatagttgaggggcataggaagccatcatcggaggtaaaccttcaccta
gcaatatatagggctaggggagacgtcaacgctgtgatacatgcacacacagtatacgct
acagcactcgccgtagcgagaagacctctcccccctgtaatcgaagaggcaatactggtg
atcgggggcgaggtcaaggtagcagagttcgcgccctacggcactcttcagctagctgag
aacgtcgtcaaggccctggagggacgtaaggcagccctcttagcgaaccatggtgttgta
gccgttggtgaaagcctcgaggaggccctggaggtgcttgtctcactcgaaaggctttca
caggtatacctgctctcagagatactcaccggggggaaaacccctctactgcctcctgaa
gccgtctccaggctcttggggaagtag

DBGET integrated database retrieval system