KEGG   Desulfurococcus mucosus: Desmu_0887Help
Entry
Desmu_0887        CDS       T01406                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dmu  Desulfurococcus mucosus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desmu_0887
Enzymes [BR:dmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Desmu_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(881291..882238)
Genome map
AA seq 315 aa AA seqDB search
MPKANTPLHVSVGNFNIDVAVYVDKMPGLDESVNAREVDIRPGGAATNYAVAVSHYGHRS
SLIASVSSNPLAKMGLETVRDMGVDVSHVSYVDAQPGMVVSIVYPDGSRSMIRSLGANAY
LTPDKVSQELLDSSSVVHMATLHPAKALEISRRTRAAMKSYDPGVYVHTDVSELREVLRH
IDVLFLNRQEYAVLTGKVDVRELFNLGVNIIVVKLGGKGAVALTRDGGVYHAYTAPQGKP
VDTTGAGDAFNAFFNAAYIDTGSVREALRYGASAGALKTLCKGSMLCWDRGLFKRHLEAS
IVEEGVNALSLISKG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgcctaaagccaatacaccactacatgtgagcgttgggaacttcaacattgatgtagca
gtatacgtggataagatgccaggtttagatgagagcgtgaatgcaagggaggtagatata
cggccaggcggtgcagccacgaattatgctgttgccgtatcacattacggccatcgctca
tcactcatagcgtcagtgtcaagcaacccattggcgaagatgggtcttgaaacagtgagg
gacatgggtgtagatgtctcccacgtctcatacgtggatgcacagccaggcatggttgta
tcaatagtctacccggatggatcaagatccatgatcaggagtctcggcgctaatgcctac
ctgacacctgacaaggtgagtcaggagctccttgattcatccagcgtggtgcacatggcg
actctccacccggcgaaggcactggagatctcgcggagaacccgtgcagccatgaaaagc
tatgacccaggcgtctacgtgcacacagatgtaagcgagctacgtgaggtattgaggcac
atagacgtgctcttcctgaataggcaggagtacgctgtgctcaccggtaaggtagatgta
cgggagctcttcaatctaggcgtaaacataatagttgttaagctcggcggtaaaggagcg
gtggcgttgaccagggatggcggggtctaccatgcgtatacagcaccgcaggggaagcct
gtggacaccacgggggccggcgatgctttcaacgcgttctttaacgctgcatacatagac
acagggagcgtgagagaggcacttaggtatggtgcctccgccggggctttaaaaacgctt
tgcaagggaagcatgttgtgctgggatagaggcctcttcaagaggcacctggaggcaagc
atagttgaggagggcgtcaacgcgttaagcctgatttcaaagggatag

DBGET integrated database retrieval system