KEGG   Desulfurococcus mucosus: Desmu_0896Help
Entry
Desmu_0896        CDS       T01406                                 

Definition
branched-chain acyl-CoA synthetase (ADP-forming) subunit alpha
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmu_0896
   00620 Pyruvate metabolism
    Desmu_0896
   00640 Propanoate metabolism
    Desmu_0896
Enzymes [BR:dmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Desmu_0896
Lipid biosynthesis proteins [BR:dmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desmu_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
888601..889986
Genome map
AA seq 461 aa AA seqDB search
MVKALFTPRSIAVIGASRTPGKIGYVVLRNIKGYGFPGKVYPVNPQADEILGYKAYPSIL
DVPDEVDVAIVTVPADAVPKVMEECGRKGVKVAVIITSGFSEVGNVELENRIVETARKYG
MRILGPNIFGYVYTPSSINATFGPLEVAKGNIALISQSGALGIALMGWTIMNEIGLSALL
SVGNMADLDVAELSEYLADDPNTRVITIYLEGIKPGKGGEFVEKMRKVTLKKPVVVIKAG
RSRRGAAAAASHTGSLAGSDNLYEAAFKQSGIIRAYTVEEMFDIARAFAAQPLPKGENTI
IITNGGGVGVLATDAAEFNDVKLLEPSQELREKLKTTMPWFGSAKNPVDLTGQAVVDNYV
KALRIAAESSEVDNIVILYCRTAVLDPRDLAKAIVELYEAEHIDKTTVAGFVGGEDTYEA
IKYLNRHNIPAYPSPERAVYALSKMVWYRRYLEARRALPQA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagccctgttcacgcctcgaagcatagcggtgatcggggctagtcgcacgccc
ggcaagatagggtacgtggtgcttaggaacattaagggatacgggttcccaggcaaagta
tatcctgtcaacccacaggcggatgaaatactggggtataaggcttacccctcaatactg
gatgtaccggacgaggtcgatgtagccatagtgactgttccagccgatgcagtacctaag
gttatggaggaatgcggtaggaaaggagtcaaggtagcagtgataatcacgtctgggttc
tccgaggtaggcaacgtcgaactggagaacaggattgttgagacagcgagaaaatacggg
atgaggatactgggccccaatatattcggctatgtctacacgccgtcaagcataaacgct
accttcgggccgctggaggttgcgaaaggcaacatcgctctcatctcgcagagcggggca
ctcggcatagcattgatgggatggacgataatgaatgaaataggtctctcagcactactc
agcgttggaaacatggcggatctcgatgtagcagagctctcagagtacttggctgatgac
ccgaatacaagggttataacgatatacctggaggggataaagccaggtaagggaggagaa
ttcgttgagaagatgaggaaggttacattgaagaagccggtggtagttataaaggcgggt
aggagcaggcgtggcgcggcagccgcggcaagccacactggcagcctagctggaagcgat
aacctatatgaggcggccttcaagcaaagcggtatcatcagggcttacaccgttgaggag
atgtttgacatagcgagggcttttgcagcacagccgttgccgaagggggaaaacaccatt
ataataaccaatggaggcggcgtcggcgtactagccaccgatgcagcggaattcaacgat
gtaaagctcctggagccaagccaggaactcagagagaagcttaaaacaacaatgccatgg
ttcggcagtgccaagaacccggttgacttaaccgggcaggcagtcgtagataactatgtg
aaggcgttaaggatagctgctgaatccagcgaggtagacaacatagttatactctactgc
aggacagccgtcctcgacccacgtgacctagcgaaggcaatagttgaactctacgaggcc
gagcacatagataagaccacggtagccgggttcgtgggcggtgaggacacgtatgaggca
ataaagtacctcaacaggcataatatcccagcgtatccttcaccagagagagcagtatac
gccctctctaaaatggtgtggtatagaaggtacttggaggctagaagagccttgccccag
gcttga

DBGET integrated database retrieval system